SecReT4
Protein ID: 222080320
T4SS name [ID]Trb [252]
Gene symboltrbB
Locus tagAvi_8334
StrainAgrobacterium vitis S4
Repliconplasmid pTiS4 [GenBank: NC_011982] [Browse all T4SS(s) in this replicon]
Location [Strand]256903..257874 [-]
Productconjugal transfer protein TrbB
Component typeTrbB
UniProt IDB9K490
KEGG IDavi:Avi_8334
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7.7e-89, Aligned region: 22..288
AAA_19 [PF13245], Evalue: 2.2e-06, Aligned region: 136..179
FtsK_SpoIIIE [PF01580], Evalue: 4.7e-06, Aligned region: 137..190
AAA_16 [PF13191], Evalue: 3.2e-05, Aligned region: 135..185
DEAD [PF00270], Evalue: 5.9e-05, Aligned region: 130..186
Protein Sequence: 323 a.a.     [Download]
>gi|222080320|ref|YP_002540184.1| P-type conjugative transfer ATPase TrbB [Agrobacterium vitis S4]
MTQLRSHPRLVRKLQDALGDQLCVALDDATVVEIMLNPDGRLFIERLGHGVARAGAMTPSAAEVVIGSVA
HALQSEADDERPIISGELPIGGHRFEGLLPPIVSGPAFTIRRRASRLIPLDDYVKSKVMTEAQASAIRSA
IDSRMNIVISGGTGSGKTTLANAIIAEIVAAAPDDRMVILEDTAEIQCAAENAVSLHTSDTVDMARLLKS
TMRLRPDRIIVGEVRDGAALTLLKAWNTGHPGGVTTIHSNTAMSALRRLEQLTAEASQQPMQEVIGEAVD
LVVSIERSGKGRRVREVIHIEGYRNSHYQTEHYAQIDEDSHVA
 
Nucleotide Sequence: 972 bp     [Download]
>gi|222080117|ref|NC_011982.1|:c257874-256903 Agrobacterium vitis S4 plasmid pTiS4, complete sequence
GTGACCCAGCTTCGCTCCCATCCGCGCCTTGTCCGCAAACTCCAGGACGCACTCGGCGACCAGCTCTGCG
TCGCCCTTGATGACGCGACGGTCGTCGAGATCATGCTCAATCCCGATGGTCGGCTGTTTATCGAGCGGCT
CGGTCATGGCGTAGCACGAGCCGGCGCAATGACGCCTTCCGCCGCCGAAGTCGTGATCGGCAGCGTCGCC
CACGCCCTGCAGTCAGAGGCTGACGATGAGCGGCCGATCATATCCGGCGAATTGCCGATCGGCGGCCACC
GTTTCGAGGGCCTGTTGCCACCGATCGTGTCCGGGCCGGCATTTACGATCCGGCGGCGGGCGTCGCGCCT
CATACCGCTCGACGATTATGTAAAGTCGAAAGTGATGACCGAAGCCCAGGCGTCTGCCATCCGCAGCGCT
ATCGATTCCCGTATGAACATCGTCATTTCGGGCGGAACTGGTTCGGGCAAGACGACGCTTGCCAATGCCA
TCATCGCCGAGATCGTCGCGGCCGCTCCGGACGATCGCATGGTCATTCTCGAAGACACCGCCGAAATCCA
ATGCGCCGCCGAGAACGCTGTCTCACTGCATACCAGCGATACGGTCGACATGGCCCGCCTCCTCAAAAGC
ACGATGCGCCTGCGTCCCGACCGCATCATTGTCGGCGAGGTTCGGGACGGCGCCGCACTGACCCTGCTGA
AAGCCTGGAACACCGGCCATCCCGGCGGTGTCACCACAATCCATTCCAACACCGCGATGTCGGCACTGCG
CAGGCTGGAACAGCTGACGGCCGAAGCAAGTCAGCAACCGATGCAGGAGGTGATCGGCGAAGCCGTCGAT
CTTGTCGTCTCCATCGAACGCTCGGGAAAGGGGAGGCGGGTCCGCGAGGTCATTCATATCGAAGGATACC
GCAACAGCCATTACCAGACCGAACATTACGCCCAGATCGACGAGGACAGCCATGTCGCGTAA
 Primer design