SecReT4
Protein ID: 222080322
T4SS name [ID]VirB [14]
Gene symbolvirB7
Locus tagAvi_8336
StrainAgrobacterium vitis S4
Repliconplasmid pTiS4 [GenBank: NC_011982] [Browse all T4SS(s) in this replicon]
Location [Strand]163605..163772 [-]
Producttype IV secretion system lipoprotein VirB7
Component typeVirB7
UniProt IDB9K412
KEGG IDavi:Avi_8336
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 55 a.a.     [Download]
>gi|222080322|ref|YP_002540106.1| VirB7 [Agrobacterium vitis S4]
MKYFLLFLILGLASCQTSDQLATSKGPVFPLNVGRWQPTQSDLQLTNAGEANDRL
 
Nucleotide Sequence: 168 bp     [Download]
>gi|222080117|ref|NC_011982.1|:c163772-163605 Agrobacterium vitis S4 plasmid pTiS4, complete sequence
TTGAAGTACTTTCTATTGTTTCTGATCCTCGGTTTGGCGTCCTGTCAGACAAGCGATCAGTTGGCGACTA
GTAAGGGGCCTGTTTTTCCGCTGAACGTCGGGCGCTGGCAGCCTACTCAGTCGGACCTTCAGCTTACCAA
CGCAGGAGAGGCTAATGATCGACTCTGA
 Primer design