SecReT4
Protein ID: 222083314
T4SS name [ID]Trb [321]
Gene symboltrbG
Locus tagAvi_9259
StrainAgrobacterium vitis S4
Repliconplasmid pAtS4c [GenBank: NC_011984] [Browse all T4SS(s) in this replicon]
Location [Strand]202858..203748 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDB9K3T4
KEGG IDavi:Avi_9259
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.5e-61, Aligned region: 80..293
Protein Sequence: 296 a.a.     [Download]
>gi|222083314|ref|YP_002542717.1| P-type conjugative transfer protein TrbG [Agrobacterium vitis S4]
MDRAALKGMAPNMNIRLRRFSVTLTAATILAVIVPFSAFLSSRALAADGVTANEAKGMGISTQWRGSRGL
VTKGPDGKVIFLYGEVQPSVVCSPLQVCDIELQSGEVVRDVLVGDTVRWKVEPATSGAAGGQAIHLIVKP
SEPNLVTSMVVTTSRRTYHIQLKSHANQYMARVGFEYPEDVSTKLADINARMEASTIPGTGVPAEQLNFS
YSVSGNAGWRPTRVYSDGEKTYIQFPRSISSQDAPVLFVVSGGQNRIVNYRMKGDMMVVDYHVDRAVLVS
GVGWKQEKVTIRRGGR
 
Nucleotide Sequence: 891 bp     [Download]
>gi|222083145|ref|NC_011984.1|:c203748-202858 Agrobacterium vitis S4 plasmid pAtS4c, complete sequence
CTGGACCGCGCAGCTTTGAAAGGCATGGCCCCGAACATGAACATTCGACTGAGACGTTTTTCGGTCACCC
TGACTGCTGCAACGATCCTCGCCGTCATCGTGCCGTTTTCGGCTTTTCTTTCCTCACGCGCGCTCGCAGC
CGATGGCGTCACCGCCAATGAGGCGAAGGGGATGGGAATTTCCACCCAGTGGCGCGGATCACGCGGACTT
GTCACGAAAGGACCGGACGGGAAGGTGATCTTCCTCTACGGCGAGGTGCAGCCCTCCGTGGTTTGTTCGC
CCTTGCAGGTCTGCGATATCGAGCTCCAGAGCGGCGAGGTGGTTCGCGACGTGCTGGTCGGCGACACCGT
CAGGTGGAAGGTCGAGCCCGCAACGTCAGGAGCGGCGGGAGGGCAGGCGATCCACCTGATCGTCAAGCCA
TCCGAGCCGAACCTTGTCACCTCGATGGTGGTGACAACCTCGCGCCGCACCTATCACATCCAGCTCAAGT
CGCATGCAAACCAATACATGGCCCGCGTCGGCTTCGAATATCCGGAAGACGTTTCCACCAAGCTCGCTGA
CATCAACGCGCGGATGGAGGCAAGCACGATCCCCGGCACCGGCGTCCCGGCCGAGCAGTTGAATTTCTCG
TATTCGGTCTCCGGCAATGCCGGCTGGCGGCCGACACGGGTCTATAGTGACGGGGAAAAGACCTACATCC
AGTTCCCGCGCTCGATCTCCAGCCAGGACGCGCCGGTTCTCTTTGTCGTCTCGGGAGGACAGAACCGCAT
CGTCAACTACCGGATGAAGGGTGACATGATGGTGGTCGACTATCACGTCGATCGTGCGGTCCTTGTTTCC
GGCGTCGGCTGGAAACAGGAGAAGGTGACGATCCGGCGGGGAGGGCGGTGA
 Primer design