SecReT4
Protein ID: 222083316
T4SS name [ID]Trb [321]
Gene symboltrbL
Locus tagAvi_9261
StrainAgrobacterium vitis S4
Repliconplasmid pAtS4c [GenBank: NC_011984] [Browse all T4SS(s) in this replicon]
Location [Strand]204407..205603 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDB9K3T6
KEGG IDavi:Avi_9261
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.7e-30, Aligned region: 67..279
Protein Sequence: 398 a.a.     [Download]
>gi|222083316|ref|YP_002542719.1| P-type conjugative transfer protein TrbL [Agrobacterium vitis S4]
MVVVRPSRKLETAFIVVAILALATAPALAQQGSVLTTLENQVVTAAKGWETTIMNAARSLFWILAGIEIG
IAAVWLAINAASLDAWFAELVRRIMFIGLFAFILDRGPALAKAVVDSLFQIGAGGGSASPANIFDAGIRV
ASKMSEQAKFGLWEDNALAIAAVFAMIVVVVAFSLVAAIFVAVMVEMYVGLLAGMIMLGLGGSSYTKDFA
VRYLVYAFSVGMKLMALVMIAKIGSDILIGLAEAPTATSDQFITTIGIAGISVVVFIIAMYVPPIIQGVV
QGASVSGGMEVIRHGGQTAAFAAGGAFLGAGAAMKGAESASSARAGGSSLAGAALRGMASCIGNAGWAAG
SAAKEKAIASPGAYAGSLLGLANAKLDQTRQSGRTSAPPPPPPVNENK
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|222083145|ref|NC_011984.1|:c205603-204407 Agrobacterium vitis S4 plasmid pAtS4c, complete sequence
ATGGTAGTCGTCCGCCCGTCCCGCAAGCTCGAAACCGCATTCATCGTCGTCGCGATCCTGGCTCTCGCGA
CCGCGCCGGCGCTCGCCCAGCAGGGCTCCGTCCTCACCACGTTGGAGAACCAGGTCGTCACCGCCGCCAA
GGGGTGGGAGACGACGATCATGAACGCGGCGCGGTCGCTGTTCTGGATTCTCGCAGGGATCGAGATCGGC
ATCGCGGCCGTGTGGCTCGCAATCAACGCCGCATCGCTTGACGCCTGGTTCGCCGAGCTCGTTCGTCGGA
TCATGTTCATAGGTCTGTTCGCCTTCATCCTCGATCGCGGCCCGGCGCTCGCGAAGGCGGTGGTCGACAG
CCTGTTCCAGATCGGCGCTGGCGGCGGGTCTGCCTCACCGGCCAACATCTTCGACGCCGGCATCCGCGTC
GCATCGAAAATGTCCGAGCAGGCAAAGTTCGGGCTGTGGGAAGACAACGCGCTGGCGATCGCCGCGGTCT
TCGCGATGATCGTGGTCGTCGTCGCGTTCTCGCTCGTCGCCGCGATCTTCGTCGCCGTCATGGTCGAGAT
GTATGTCGGCTTGCTCGCCGGCATGATCATGCTCGGGCTCGGCGGCAGCTCGTACACCAAGGATTTCGCG
GTCCGCTACCTGGTCTATGCCTTCTCCGTCGGCATGAAGCTGATGGCGCTCGTCATGATCGCCAAGATCG
GCTCCGACATTCTGATCGGGCTGGCCGAGGCGCCGACGGCGACCTCCGACCAGTTCATCACCACGATCGG
CATCGCCGGCATCTCCGTCGTTGTGTTCATCATCGCCATGTATGTGCCGCCGATCATCCAGGGTGTCGTG
CAGGGCGCGTCGGTCTCTGGCGGCATGGAGGTGATCCGCCATGGTGGCCAGACGGCCGCCTTCGCTGCCG
GCGGCGCCTTCCTCGGTGCGGGCGCCGCGATGAAGGGGGCAGAATCAGCGAGCTCGGCGAGGGCGGGGGG
CTCGTCCCTGGCGGGAGCGGCTCTTCGCGGCATGGCGTCCTGCATCGGCAATGCGGGTTGGGCAGCGGGA
TCGGCCGCGAAGGAGAAGGCGATCGCTTCACCCGGAGCCTATGCCGGCTCGTTGCTCGGCCTCGCCAACG
CCAAGCTCGACCAGACGCGGCAATCCGGCAGAACCTCGGCGCCTCCTCCGCCTCCACCCGTCAACGAAAA
CAAGTAA
 Primer design