SecReT4
Protein ID: 222083321
T4SS name [ID]Trb [321]
Gene symboltrbC
Locus tagAvi_9268
StrainAgrobacterium vitis S4
Repliconplasmid pAtS4c [GenBank: NC_011984] [Browse all T4SS(s) in this replicon]
Location [Strand]209367..209771 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDB9K3U1
KEGG IDavi:Avi_9268
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 8.7e-22, Aligned region: 3..100
Protein Sequence: 134 a.a.     [Download]
>gi|222083321|ref|YP_002542724.1| conjugal transfer protein [Agrobacterium vitis S4]
MSHKTRITVALAAFAAISSVILADPAFASSGGSLPWESPLQQIQQSITGPVAGFIALAAVAIAGGMLIFG
GELNDFARRLCYVALVGGVLLGATQIVALFGATGASIGEIEARTRSGIAEQSATLRPEGEGAHG
 
Nucleotide Sequence: 405 bp     [Download]
>gi|222083145|ref|NC_011984.1|:c209771-209367 Agrobacterium vitis S4 plasmid pAtS4c, complete sequence
ATGTCGCATAAGACCAGGATTACCGTTGCGCTTGCGGCATTCGCCGCCATCTCCAGCGTCATTCTGGCGG
ATCCGGCCTTCGCCTCTTCAGGCGGTAGTCTGCCCTGGGAATCTCCGCTGCAGCAGATCCAGCAGTCCAT
CACCGGGCCGGTTGCCGGCTTCATCGCGCTCGCGGCGGTCGCCATCGCTGGTGGTATGCTGATTTTCGGG
GGCGAGTTGAATGACTTCGCAAGGCGGCTTTGCTACGTCGCCCTCGTTGGCGGCGTGTTGCTCGGCGCGA
CCCAGATCGTCGCACTCTTCGGTGCGACCGGCGCTTCGATCGGCGAGATAGAGGCCCGAACCAGATCTGG
GATCGCCGAACAGTCAGCAACACTTCGACCGGAAGGGGAGGGGGCTCATGGCTGA
 Primer design