SecReT4
Protein ID: 222087802
T4SS name [ID]VirB [190]
Gene symbolavhB11
Locus tagArad_4780
StrainAgrobacterium radiobacter K84
Repliconchromosome 1 [GenBank: NC_011985] [Browse all T4SS(s) in this replicon]
Location [Strand]3865959..3866948 [-]
Producttype IV secretion protein AvhB11
Component typeVirB11
UniProt IDB9JE61
KEGG IDara:Arad_4780
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.4e-85, Aligned region: 15..316
AAA_18 [PF13238], Evalue: 2.5e-05, Aligned region: 166..209
AAA_17 [PF13207], Evalue: 3.3e-05, Aligned region: 166..216
Protein Sequence: 329 a.a.     [Download]
>gi|222087802|ref|YP_002546340.1| type IV secretion protein AvhB11 [Agrobacterium radiobacter K84]
MAEASDAGVVRELLLPLSRFLKDTSLYEIVINRPGEVLTEGTKGWQHHALPDLSFEKLMRLARAIASYSN
QAIDEVRPVLSATLPDEERIQVVVPPATTKGTVSVTIRKPSSVTLTLDDLEEGGLFSNVSSLNRHVESSD
AKLDKILKAGNYATFLRAAVLARKNIIISGATGSGKTTLSKALIRHIPEHERIISIEDTPELVIPQPNHV
RLFYSKGGQGLAKISAKDLLESCLRMRPDRILLQELRDGSAFYYIRNVNSGHPGSITTVHADSAALAFEQ
LTLLVKESEGGRDLERNDVRSLLKVAIDIIVQCKRIDGRFRVNEIYFEP
 
Nucleotide Sequence: 990 bp     [Download]
>gi|222084201|ref|NC_011985.1|:c3866948-3865959 Agrobacterium radiobacter K84 chromosome 1, complete sequence
ATGGCGGAAGCTTCAGATGCTGGTGTCGTGCGTGAATTGCTTTTGCCACTGTCTCGCTTCCTAAAGGATA
CGTCGCTCTATGAGATCGTCATCAACCGCCCGGGTGAAGTCCTGACCGAGGGAACGAAGGGATGGCAGCA
CCACGCACTGCCGGATCTTAGCTTCGAGAAGCTCATGCGTCTGGCCCGGGCCATTGCAAGCTATTCGAAC
CAGGCAATCGACGAGGTCCGGCCGGTCTTGTCGGCCACCTTGCCAGATGAAGAGCGGATTCAGGTCGTTG
TTCCGCCGGCAACGACCAAGGGCACGGTCAGCGTCACGATCAGAAAGCCGTCGTCAGTGACGCTGACGTT
GGATGATCTCGAAGAGGGTGGATTATTTTCCAATGTCTCCTCGCTGAACCGTCATGTCGAATCCTCCGAT
GCGAAGTTGGACAAGATCCTTAAGGCAGGCAATTACGCGACGTTTCTGCGTGCGGCGGTTCTTGCGCGCA
AGAACATCATCATCTCGGGCGCGACCGGATCGGGCAAGACCACCCTGTCGAAGGCATTGATCCGGCATAT
CCCGGAGCACGAGCGGATTATCTCGATCGAGGATACGCCGGAGTTGGTCATCCCACAGCCCAATCACGTC
AGGCTTTTCTATTCGAAAGGAGGGCAGGGGCTGGCGAAAATCAGCGCGAAAGACCTGCTCGAATCGTGCC
TTAGGATGCGACCCGATCGCATTCTTTTACAGGAGCTGCGCGACGGTTCGGCCTTCTACTACATCCGCAA
TGTCAATTCAGGACACCCTGGATCGATCACAACGGTGCATGCCGATTCTGCGGCGCTAGCATTCGAGCAA
CTGACGTTGCTCGTGAAAGAGTCGGAAGGAGGTCGCGACCTCGAGCGCAACGATGTTCGTAGTTTGCTCA
AGGTCGCAATCGATATCATTGTCCAGTGCAAGCGGATCGACGGGCGGTTTCGGGTGAACGAGATTTACTT
TGAGCCATGA
 Primer design