SecReT4
Protein ID: 222087804
T4SS name [ID]VirB [190]
Gene symbolavhB8
Locus tagArad_4783
StrainAgrobacterium radiobacter K84
Repliconchromosome 1 [GenBank: NC_011985] [Browse all T4SS(s) in this replicon]
Location [Strand]3869000..3869671 [-]
Producttype IV secretion protein AvhB8
Component typeVirB8
UniProt IDB9JE64
KEGG IDara:Arad_4783
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.9e-66, Aligned region: 13..220
Protein Sequence: 223 a.a.     [Download]
>gi|222087804|ref|YP_002546343.1| type IV secretion protein AvhB8 [Agrobacterium radiobacter K84]
MVTTDSLKAYFDKARRFDQDRMIQMERSVRIAWFVATGAGVLAAISTVAIAGLTPLKTVEPFVVRVDNAT
GIVDVVSALTSTAGTYDEAVTKYFAARYVRARESYVWSEAEENFRTVSLLSTAPEQTRFAAIYRGGNPDS
PQNIYGRGATSRISIVSISLINAKVVSVRYMRTITRGDETHTTHWVATLTFAYVNAPMSSTDRLVNPLGF
VVSDYRSDPEAIN
 
Nucleotide Sequence: 672 bp     [Download]
>gi|222084201|ref|NC_011985.1|:c3869671-3869000 Agrobacterium radiobacter K84 chromosome 1, complete sequence
ATGGTGACGACGGACAGTCTCAAGGCTTATTTCGACAAGGCCCGGCGGTTCGATCAGGACCGCATGATCC
AGATGGAGCGTTCGGTTCGGATTGCCTGGTTCGTAGCCACCGGGGCCGGTGTTCTTGCGGCGATTTCGAC
CGTAGCTATCGCAGGCTTGACACCGCTGAAGACGGTCGAGCCCTTTGTCGTGAGAGTCGACAATGCCACC
GGCATTGTCGATGTCGTTTCGGCACTCACGTCGACCGCTGGCACCTACGACGAAGCGGTGACCAAATATT
TTGCCGCCCGCTATGTTCGTGCCCGCGAGAGTTATGTCTGGAGCGAGGCGGAGGAGAATTTTCGCACGGT
TTCGCTACTCTCAACGGCGCCGGAACAGACCCGCTTTGCCGCGATTTATCGCGGCGGCAATCCGGATTCC
CCGCAAAATATCTACGGCCGCGGTGCCACATCGCGGATCAGCATTGTTTCCATCTCGCTGATCAACGCCA
AGGTAGTCTCCGTTCGTTATATGCGCACCATTACCCGCGGCGACGAGACCCATACGACCCATTGGGTAGC
AACGCTTACCTTCGCCTATGTGAACGCTCCAATGTCCTCGACCGATCGGCTGGTCAATCCGCTCGGCTTC
GTCGTCAGCGACTATCGATCCGATCCGGAGGCCATCAATTGA
 Primer design