SecReT4
Protein ID: 222087806
T4SS name [ID]VirB [190]
Gene symbolavhB7
Locus tagArad_4785
StrainAgrobacterium radiobacter K84
Repliconchromosome 1 [GenBank: NC_011985] [Browse all T4SS(s) in this replicon]
Location [Strand]3869671..3869958 [-]
Producttype IV secretion protein AvhB7
Component typeVirB7
UniProt IDB9JE65
KEGG IDara:Arad_4785
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 95 a.a.     [Download]
>gi|222087806|ref|YP_002546344.1| type IV secretion protein AvhB7 [Agrobacterium radiobacter K84]
MIRIFVLFCVASTLGGCASLSYPLPKCDGYSRRPLNRAMWQWDGDSRSMPQPPNSSPALSGGKPPAYVEA
EPDIVPAAFAHFDVGNSYRPCGGPR
 
Nucleotide Sequence: 288 bp     [Download]
>gi|222084201|ref|NC_011985.1|:c3869958-3869671 Agrobacterium radiobacter K84 chromosome 1, complete sequence
ATGATCCGAATATTCGTGCTTTTTTGCGTGGCGTCAACGCTCGGCGGCTGCGCGTCACTTTCCTATCCCC
TGCCCAAATGCGACGGCTATTCGCGCCGACCACTCAATCGCGCTATGTGGCAATGGGACGGCGATAGTCG
GTCCATGCCGCAACCTCCTAACTCTTCACCAGCACTGTCCGGCGGCAAGCCACCTGCCTATGTCGAGGCA
GAGCCGGATATCGTTCCCGCCGCCTTCGCGCATTTCGATGTCGGCAATTCCTATCGTCCATGCGGAGGGC
CGCGGTGA
 Primer design