SecReT4
Protein ID: 222087829
T4SS name [ID]VirB [190]
Gene symboltraG
Locus tagArad_4814
StrainAgrobacterium radiobacter K84
Repliconchromosome 1 [GenBank: NC_011985] [Browse all T4SS(s) in this replicon]
Location [Strand]3889956..3891869 [+]
Productconjugal transfer coupling protein TraG
Component typeVirD4
UniProt IDB9JE88
KEGG IDara:Arad_4814
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.1e-94, Aligned region: 169..627
TraG-D_C [PF12696], Evalue: 1.6e-31, Aligned region: 473..596
TrwB_AAD_bind [PF10412], Evalue: 5.4e-21, Aligned region: 436..612
Protein Sequence: 637 a.a.     [Download]
>gi|222087829|ref|YP_002546367.1| conjugal transfer coupling protein TraG [Agrobacterium radiobacter K84]
MALRYRVHPSLVLTLVPIAVTTLTLCITGWRWQDLAIGMPARITYWFLRAVPLPNLVLGPIASLLTVWAL
PLHRRRPIASTSLLCFLYVAGFYALREYARLAPWVKNGVITWNEARTYLDAFAVAGTILGFGIVAISARI
SIVVSNPIKRAKRGIFGDADWLPMPKVAKLFPSDGEIVIGERYRVDHDRVHALPFDPNDYGTWGKGGKAP
LMTFNQNFDSTHMLFFAGSGGFKTTSNVIPTALRYRGPLICLDPSTEVAPMVLEHRAHALGREVMVLDPT
NPVMGFNVLDGIERSTRKEEDIVGIAHMLLSESLRFESSTGSYFQNQAHNLLTGLLAHVMLSPDYAGRRN
LRSLRLIVSEPEPSVLAMLRDIQENSASAFIRETLGVFTNMTEQTFSGVYSTASKDTQWLSLDNYAALVC
GDAFKSSDIASGRKDIFLNIPASILRSYPGIGRVIIGSLINAMVQADGDFYHRALFMLDEVDLLGYIRIL
EEARDRGRKYGITLMLMYQSVGQLERHFGKDGATSWIEGCAFTSYAAIKALDTARNVSAQCGEMTVEVQG
RSRNVGWSNSNSSARKSESVSLQRRPLIMPHEITQSMRKDEQIIIVQGHSPIRCGRAIYFRRKELDEAAK
FNRFAKF
 
Nucleotide Sequence: 1914 bp     [Download]
>gi|222084201|ref|NC_011985.1|:3889956-3891869 Agrobacterium radiobacter K84 chromosome 1, complete sequence
ATGGCGCTAAGGTACAGAGTGCATCCGAGCTTGGTGCTCACCCTGGTGCCGATCGCAGTGACAACACTGA
CGCTCTGTATCACCGGATGGCGGTGGCAGGATTTGGCGATCGGCATGCCAGCAAGGATCACCTATTGGTT
CCTTCGAGCGGTTCCTCTTCCCAATCTCGTGCTCGGACCTATCGCCTCACTTCTGACGGTTTGGGCATTG
CCCCTGCATCGCCGTCGGCCGATCGCTTCGACGAGCCTACTTTGCTTTCTATACGTGGCAGGCTTTTACG
CCCTGCGGGAATATGCCCGTCTCGCTCCATGGGTGAAGAATGGTGTCATCACATGGAACGAGGCTCGCAC
TTATCTCGACGCCTTCGCGGTTGCCGGGACCATTCTCGGATTTGGTATTGTCGCAATCTCCGCGCGCATC
TCGATCGTCGTTTCCAATCCGATCAAACGCGCCAAGCGCGGCATCTTCGGCGATGCCGATTGGCTGCCCA
TGCCGAAGGTGGCGAAGCTTTTCCCCTCGGACGGGGAGATCGTCATTGGCGAGCGCTACCGAGTCGACCA
TGACCGCGTGCATGCGCTGCCTTTTGATCCGAATGATTACGGGACTTGGGGGAAAGGTGGCAAGGCGCCG
CTCATGACCTTCAATCAGAATTTCGATTCCACCCATATGTTGTTCTTCGCGGGCTCCGGCGGCTTTAAGA
CGACCAGCAACGTCATCCCGACGGCGCTGCGCTACAGGGGGCCGCTGATCTGTCTCGATCCATCGACGGA
GGTCGCGCCGATGGTTCTCGAACATCGCGCCCATGCGCTAGGCCGCGAAGTCATGGTACTCGACCCCACC
AATCCGGTCATGGGCTTCAACGTTCTTGATGGGATCGAGAGATCGACACGCAAGGAAGAGGACATCGTTG
GTATCGCCCATATGCTTTTGTCCGAAAGCCTGCGCTTCGAATCCTCGACTGGCTCCTATTTCCAGAACCA
GGCGCACAATCTACTAACTGGTCTTCTGGCGCATGTGATGCTGTCGCCAGATTATGCCGGCCGCCGCAAC
TTGCGCAGCCTGCGTCTAATCGTTTCCGAGCCGGAACCGTCGGTGCTTGCCATGCTGCGCGACATCCAAG
AAAATTCCGCGTCCGCCTTTATTCGCGAGACGCTAGGCGTCTTCACCAACATGACGGAGCAGACTTTCTC
CGGGGTCTATTCGACCGCATCCAAGGATACGCAGTGGTTGTCGCTCGACAATTATGCCGCGCTTGTCTGC
GGTGATGCGTTCAAATCGAGCGACATCGCTTCTGGACGGAAGGACATCTTCCTCAATATCCCCGCTTCGA
TCCTGCGCTCCTATCCGGGCATTGGCCGGGTGATCATCGGCTCGCTGATCAATGCCATGGTCCAGGCCGA
CGGCGACTTCTACCACCGAGCGCTCTTCATGCTTGATGAGGTCGATTTGCTGGGCTACATCCGTATTCTT
GAAGAAGCACGGGACCGCGGGCGCAAGTATGGCATCACACTGATGCTGATGTACCAATCTGTCGGCCAAC
TCGAGCGTCATTTCGGGAAGGACGGAGCGACCTCCTGGATTGAAGGCTGCGCCTTCACATCCTATGCCGC
AATTAAGGCGCTCGATACAGCCCGCAATGTCTCCGCCCAATGCGGAGAGATGACCGTCGAAGTCCAGGGG
CGTTCGCGTAATGTCGGTTGGAGCAATTCCAATAGCAGCGCCCGCAAATCCGAAAGCGTAAGTCTCCAGC
GCCGGCCGCTGATCATGCCGCACGAAATCACCCAGTCGATGCGCAAGGATGAGCAGATCATCATTGTCCA
GGGCCACAGTCCCATTCGCTGCGGACGAGCGATCTATTTCCGCCGCAAGGAGCTGGATGAGGCGGCAAAG
TTCAATCGCTTTGCGAAGTTCTAG
 Primer design