SecReT4
Protein ID: 222102010
T4SS name [ID]VirB [420]
Gene symbol-
Locus tagArad_12060
StrainAgrobacterium radiobacter K84
Repliconplasmid pAtK84c [GenBank: NC_011987] [Browse all T4SS(s) in this replicon]
Location [Strand]43339..44043 [+]
Producttransglycosylase SLT domain protein
Component typeVirB1
UniProt IDB9JPR7
KEGG IDara:Arad_12060
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 234 a.a.     [Download]
>gi|222102010|ref|YP_002546600.1| transglycosylase SLT domain protein [Agrobacterium radiobacter K84]
MSIASVRAAALAATLVFPSLVLANGVSPISIAATVPASSDCPDGAADAETIRQLITNETARQGVDARLAL
AIADQESGFGAHVNSPAGARGPMQLMPATAARYKVADICDAAQNIRGGVSYLKDLSAMFGGNIMLVVAAY
NAGEGRVVAARGVPAIAETVSYTALVTNAYFGFDSILKGGKRPSQAVKPDTRAAEAGVDLLAETPSPDKP
IPINQTRTEAGDRDWIGGSVLYVQ
 
Nucleotide Sequence: 705 bp     [Download]
>gi|222101962|ref|NC_011987.1|:43339-44043 Agrobacterium radiobacter K84 plasmid pAtK84c, complete sequence
ATGTCCATAGCCTCCGTCCGTGCTGCGGCGCTTGCCGCAACCCTTGTTTTTCCGTCGCTGGTTCTGGCAA
ATGGCGTGTCGCCAATCTCGATCGCTGCCACCGTCCCAGCCTCGTCTGACTGCCCCGATGGTGCGGCGGA
TGCGGAGACTATTCGGCAGCTGATCACTAACGAGACGGCGCGACAGGGTGTTGACGCCAGGTTGGCGCTT
GCCATTGCCGATCAGGAGTCCGGCTTCGGCGCCCACGTCAATTCGCCGGCGGGTGCGCGCGGCCCCATGC
AGCTCATGCCGGCAACGGCCGCACGCTACAAGGTGGCGGACATTTGCGATGCGGCTCAGAACATTCGCGG
TGGCGTCAGCTACCTCAAGGATCTCTCCGCCATGTTCGGCGGCAACATCATGCTGGTGGTTGCCGCCTAT
AATGCAGGAGAGGGCCGCGTCGTTGCAGCCCGTGGCGTGCCGGCGATTGCCGAGACCGTTTCCTACACAG
CACTCGTCACCAACGCCTATTTTGGCTTCGACAGTATTTTAAAGGGCGGCAAGCGGCCTAGCCAGGCAGT
CAAACCGGACACTCGAGCAGCTGAAGCCGGTGTCGACCTGCTGGCGGAAACGCCATCGCCCGACAAACCA
ATCCCCATCAACCAAACCAGAACTGAAGCCGGCGACCGCGATTGGATCGGCGGCTCGGTTCTTTACGTGC
AGTAG
 Primer design