SecReT4
Protein ID: 222102011
T4SS name [ID]VirB [420]
Gene symbol-
Locus tagArad_12061
StrainAgrobacterium radiobacter K84
Repliconplasmid pAtK84c [GenBank: NC_011987] [Browse all T4SS(s) in this replicon]
Location [Strand]44061..44414 [+]
Producttype IV secretion protein
Component typeVirB2
UniProt IDB9JPR8
KEGG IDara:Arad_12061
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6.9e-17, Aligned region: 22..110
Protein Sequence: 117 a.a.     [Download]
>gi|222102011|ref|YP_002546601.1| type IV secretion protein [Agrobacterium radiobacter K84]
MKANLYNPARSAMSSRPISGNSLVLVAIAGAMAIGNADMAYAAGDIFQPINSVFTTLLNFMTGTFATTAA
TIACAAVGYMALTSRIPWSWCFSIIVGIAFIFGGAQLVSSMSSGLGG
 
Nucleotide Sequence: 354 bp     [Download]
>gi|222101962|ref|NC_011987.1|:44061-44414 Agrobacterium radiobacter K84 plasmid pAtK84c, complete sequence
ATGAAGGCAAACTTGTATAATCCCGCCCGGTCCGCGATGTCCTCGCGACCGATCAGTGGAAACAGCCTGG
TCCTCGTGGCCATTGCCGGTGCTATGGCGATCGGTAACGCCGATATGGCTTATGCCGCCGGTGACATTTT
CCAACCGATCAATTCGGTGTTCACGACGCTTCTCAACTTCATGACCGGAACCTTCGCCACGACGGCCGCG
ACCATCGCTTGTGCTGCGGTCGGCTATATGGCGCTGACCAGCCGCATCCCGTGGAGCTGGTGCTTCTCCA
TTATCGTCGGTATCGCCTTCATCTTTGGCGGCGCGCAGCTGGTGTCCTCCATGTCGTCCGGATTGGGCGG
CTGA
 Primer design