SecReT4
Protein ID: 222102012
T4SS name [ID]VirB [420]
Gene symbol-
Locus tagArad_12063
StrainAgrobacterium radiobacter K84
Repliconplasmid pAtK84c [GenBank: NC_011987] [Browse all T4SS(s) in this replicon]
Location [Strand]44414..44710 [+]
Producttype IV secretion protein
Component typeVirB3
UniProt IDB9JPR9
KEGG IDara:Arad_12063
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 9.1e-16, Aligned region: 1..92
Protein Sequence: 98 a.a.     [Download]
>gi|222102012|ref|YP_002546602.1| type IV secretion protein [Agrobacterium radiobacter K84]
MSEAQAKAEVAPLVLGLTRPRMFWGVPIGLFVGELMIVVMTFLNTKNLAMFLLFLPLHAAAYVITVRDPH
LPNVVRVRIAKCPWTKNRHFWGGNSYEP
 
Nucleotide Sequence: 297 bp     [Download]
>gi|222101962|ref|NC_011987.1|:44414-44710 Agrobacterium radiobacter K84 plasmid pAtK84c, complete sequence
ATGAGCGAGGCGCAGGCAAAGGCGGAAGTGGCACCCCTCGTTCTCGGCCTTACCCGGCCGAGGATGTTTT
GGGGCGTGCCGATCGGTCTGTTTGTGGGCGAGTTGATGATCGTCGTCATGACGTTCCTCAACACGAAGAA
CCTGGCAATGTTCCTTCTCTTCCTGCCTCTGCATGCCGCAGCCTATGTGATCACGGTGCGCGATCCGCAT
TTACCGAACGTCGTTCGGGTGCGGATCGCCAAATGCCCCTGGACGAAGAACCGCCACTTCTGGGGCGGCA
ATTCCTATGAACCCTAA
 Primer design