SecReT4
Protein ID: 222102013
T4SS name [ID]VirB [420]
Gene symbolavhB4a
Locus tagArad_12064
StrainAgrobacterium radiobacter K84
Repliconplasmid pAtK84c [GenBank: NC_011987] [Browse all T4SS(s) in this replicon]
Location [Strand]44736..47180 [+]
Producttype IV secretion protein
Component typeVirB4
UniProt IDB9JPS0
KEGG IDara:Arad_12064
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 1.4e-42, Aligned region: 195..391
AAA_10 [PF12846], Evalue: 7.5e-36, Aligned region: 444..727
Protein Sequence: 814 a.a.     [Download]
>gi|222102013|ref|YP_002546603.1| type IV secretion protein [Agrobacterium radiobacter K84]
MQKAVRKDLRFGAEIAREKPISAHVPYLRHVDEETLRTKDGMLLTIIKVGGFCHQTADQQIIDVEATARN
TLVRALADSRFAVYSHIVRRRIPPDIGGAFDIPFCKNLDERYMASLADSRMYTNELYLTIIRRGFQGRVG
LADALMSHFRKAAGMSEQALDREALQELRQHVANIVKGMEHYGVRILKAVLREYSVASEPLEFLAMLLNG
GQQVNMALPRMPLDQYLPTRRITFGRRMFEMRGGSDDDTRFGAMLSIREYPPYTAAGMIDGLLKAPGEFV
VSQSFALQDRAPILSEMDRIERQISVSDERGTSLESAISIAKDELVNGRSVMGYHHLTVMALGNTIKETE
SSAQAITKELQNAGMVVVREDLNAEPAFYAQLPGNFAYIARRALISSRNFCGLASYHNFALGKPAGNHWG
PAVSLLQTTSMTPYFFNFHKGEVGNFIVTGPTGSGKTVALLFLLSQAMRARPQPRCAFFDKDRGGEIFIR
ACGGQYEVLQPGMASGFNPLQLEDSPDNRAFVHDLLSYLVRPKNEAEKLSAEQEKILARAVDHIFNVPIR
ERLFSDVIHLLRGGEAAGRDDLASRFEAWCDTRGWLFNNPVDLWNSDRGVFGFDLTAVLDDPEIRTAALG
YIFFRIGQMLDGERPMMLFVDEGWKLLGDDKAGAFINDQLKTIRKKNGIVGIGTQSARDITTSRIAHTLL
EQSPTNIFFPNPKADRESYVTGFGLSEVEFEWVKSTSSTSRQFLVKHDHDSVIARLDLSGLPDFIKVLSG
RAETVAECERLRHRHGDAPEHWLPYFCGWRQEPSNLSGSQAEAQ
 
Nucleotide Sequence: 2445 bp     [Download]
>gi|222101962|ref|NC_011987.1|:44736-47180 Agrobacterium radiobacter K84 plasmid pAtK84c, complete sequence
ATGCAAAAGGCAGTCCGCAAGGATCTTCGCTTCGGCGCCGAGATCGCCCGCGAAAAGCCGATCTCAGCGC
ATGTCCCCTATCTGCGGCATGTCGACGAGGAGACGCTGCGGACCAAAGACGGCATGCTGCTGACGATCAT
CAAGGTCGGTGGCTTTTGTCACCAGACCGCCGATCAACAGATCATCGATGTCGAGGCGACGGCGCGCAAC
ACCTTGGTTCGAGCCCTCGCCGACAGCAGGTTTGCCGTCTACTCCCATATCGTGCGGCGGCGTATTCCGC
CTGATATCGGCGGCGCCTTCGACATTCCGTTCTGCAAAAATCTAGACGAGCGCTATATGGCGAGTCTGGC
TGACAGCCGCATGTACACCAACGAACTCTACCTGACGATCATCCGGCGCGGTTTTCAGGGGAGGGTGGGC
CTTGCCGATGCGCTGATGTCGCATTTCCGCAAGGCCGCGGGGATGTCCGAGCAGGCGCTCGATCGAGAAG
CACTCCAGGAGCTTCGCCAGCACGTCGCTAATATCGTCAAGGGCATGGAGCATTATGGCGTCCGGATCCT
GAAGGCGGTGCTGCGCGAGTACAGTGTTGCCTCTGAGCCGCTGGAGTTTCTGGCCATGCTTTTGAATGGC
GGCCAACAGGTCAACATGGCTCTGCCGCGCATGCCGCTCGACCAATATCTGCCGACACGCCGTATTACAT
TTGGGCGGCGGATGTTCGAGATGCGAGGAGGCAGCGACGATGACACCCGGTTCGGCGCGATGCTGTCGAT
CCGCGAATACCCGCCCTATACCGCCGCGGGAATGATCGATGGGCTGTTAAAAGCCCCCGGCGAATTTGTC
GTCTCGCAAAGCTTTGCGCTGCAGGATCGTGCGCCAATCCTGTCCGAGATGGATCGGATCGAACGTCAGA
TCAGCGTTTCGGACGAGCGTGGCACCAGCCTTGAAAGCGCGATCTCGATTGCTAAGGATGAGCTGGTCAA
TGGCCGCTCTGTCATGGGCTATCACCATCTGACGGTCATGGCGCTCGGCAATACCATCAAGGAAACCGAG
TCCAGCGCCCAGGCAATCACCAAGGAACTGCAAAATGCGGGCATGGTGGTCGTGCGCGAGGATCTGAATG
CCGAGCCCGCCTTCTATGCGCAGCTTCCGGGCAACTTTGCCTATATTGCCAGGCGAGCGCTAATCTCGTC
ACGGAATTTTTGCGGCCTGGCGTCCTATCATAATTTCGCGCTCGGCAAGCCCGCTGGCAATCACTGGGGG
CCGGCGGTGTCGTTGCTGCAGACAACGTCGATGACGCCTTACTTTTTCAACTTCCATAAGGGCGAAGTCG
GTAACTTCATCGTCACCGGCCCGACAGGGTCGGGCAAGACGGTGGCGCTGCTTTTTCTCCTGTCGCAGGC
AATGCGGGCACGGCCGCAGCCGCGTTGCGCCTTCTTCGACAAGGACCGCGGCGGCGAGATTTTTATCCGT
GCCTGCGGCGGCCAATATGAGGTGCTGCAGCCCGGCATGGCCTCAGGCTTCAACCCGTTGCAGCTCGAAG
ACAGTCCCGACAACCGGGCGTTCGTCCACGATTTGCTCAGCTACCTGGTCCGCCCGAAGAATGAGGCCGA
AAAGTTGTCGGCCGAACAGGAGAAGATTCTGGCTCGAGCGGTAGATCATATATTCAACGTGCCGATCCGG
GAGCGATTGTTCTCCGACGTCATCCACCTGTTGCGGGGCGGCGAGGCCGCCGGCCGCGACGATCTGGCAT
CGCGTTTTGAGGCCTGGTGTGACACGCGTGGATGGCTGTTCAACAACCCGGTCGATCTCTGGAATTCGGA
TCGTGGCGTCTTCGGCTTTGATCTGACGGCAGTCCTCGACGATCCGGAAATCCGCACGGCAGCACTCGGC
TATATCTTCTTCCGGATCGGCCAGATGCTGGATGGAGAGCGGCCGATGATGCTCTTCGTCGACGAGGGCT
GGAAGCTGTTAGGCGACGACAAGGCAGGTGCCTTCATCAATGACCAGCTCAAAACCATCCGCAAGAAGAA
CGGGATTGTCGGGATTGGAACGCAATCGGCTCGCGACATCACGACATCGCGGATCGCGCACACGCTTCTC
GAGCAGAGCCCGACGAACATCTTCTTTCCGAATCCGAAGGCGGACCGGGAAAGCTATGTGACGGGTTTTG
GGCTCTCCGAAGTCGAGTTCGAATGGGTCAAATCCACCTCTTCGACGAGCCGTCAGTTCCTGGTCAAGCA
TGACCACGACAGCGTAATTGCGCGTCTGGATCTCTCAGGCCTTCCGGACTTCATCAAGGTCCTGTCCGGC
CGAGCCGAAACGGTTGCAGAGTGCGAGCGGTTACGCCATCGCCATGGCGACGCACCGGAACACTGGCTCC
CGTATTTCTGCGGTTGGAGGCAAGAGCCCTCCAATCTCTCAGGAAGTCAGGCGGAAGCGCAATGA
 Primer design