SecReT4
Protein ID: 222102015
T4SS name [ID]VirB [420]
Gene symbol-
Locus tagArad_12066
StrainAgrobacterium radiobacter K84
Repliconplasmid pAtK84c [GenBank: NC_011987] [Browse all T4SS(s) in this replicon]
Location [Strand]47838..48572 [+]
Producthypothetical protein
Component typeVirB5
UniProt IDB9JPS2
KEGG IDara:Arad_12066
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 1.2e-09, Aligned region: 26..204
Protein Sequence: 244 a.a.     [Download]
>gi|222102015|ref|YP_002546605.1| hypothetical protein Arad_12066 [Agrobacterium radiobacter K84]
MKIFKTLPAALVVAIAVAPCGGVFAQVPVIDDATLSQATKTASNTAQIMSSNSDILQTVNRTLAAVTGNR
STSEIAGTALGSGFSIGSAPDFSSLLSGQMSWGNLGSFGNTAATILNGLNLVKTLSGQTGSANLTRGDKA
YQGLVNTATALTASIAGTQNSAQQRSTAFQAVQGQIGAATDIKGSIDQNSQVQTQTAQTVNELVGAVNAG
NAALNAEQVRQLAAEAATAAFMTYDAGQVSFVGH
 
Nucleotide Sequence: 735 bp     [Download]
>gi|222101962|ref|NC_011987.1|:47838-48572 Agrobacterium radiobacter K84 plasmid pAtK84c, complete sequence
ATGAAAATATTCAAAACCCTGCCGGCTGCCCTGGTCGTCGCCATTGCAGTGGCTCCATGCGGCGGTGTCT
TTGCCCAGGTGCCTGTCATCGACGACGCGACCCTGTCACAGGCCACCAAGACTGCCTCGAACACTGCTCA
GATCATGTCGTCGAACAGCGATATCCTGCAAACGGTAAACAGGACGCTTGCTGCGGTCACGGGAAATCGC
TCGACCAGTGAGATCGCGGGTACGGCTCTTGGCTCGGGCTTTTCGATCGGGAGCGCGCCCGATTTTTCCT
CACTTCTCAGCGGTCAGATGTCCTGGGGCAATCTCGGTTCGTTCGGCAATACCGCTGCAACGATCCTGAA
CGGGTTGAACCTGGTCAAAACCCTGTCCGGCCAGACCGGAAGTGCAAATTTGACGCGGGGCGACAAGGCC
TATCAGGGCCTGGTGAATACGGCGACGGCGCTGACCGCCTCCATCGCCGGAACGCAAAACAGCGCCCAGC
AACGCTCGACCGCCTTCCAGGCGGTTCAGGGGCAGATCGGGGCGGCAACCGACATCAAGGGCTCGATCGA
TCAGAATTCGCAAGTGCAGACCCAGACCGCGCAAACGGTCAACGAACTCGTCGGTGCTGTGAATGCCGGA
AACGCGGCCCTCAATGCCGAGCAGGTGCGCCAACTGGCGGCGGAAGCCGCAACGGCGGCATTCATGACCT
ATGACGCGGGCCAGGTCTCCTTCGTGGGCCATTGA
 Primer design