SecReT4
Protein ID: 222102017
T4SS name [ID]VirB [420]
Gene symbolavhB6a
Locus tagArad_12068
StrainAgrobacterium radiobacter K84
Repliconplasmid pAtK84c [GenBank: NC_011987] [Browse all T4SS(s) in this replicon]
Location [Strand]48858..49820 [+]
Producttype IV secretion protein
Component typeVirB6
UniProt IDB9JPS4
KEGG IDara:Arad_12068
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.6e-40, Aligned region: 17..247
Protein Sequence: 320 a.a.     [Download]
>gi|222102017|ref|YP_002546607.1| type IV secretion protein [Agrobacterium radiobacter K84]
MYTTLASYLGPLFLAALTVYVVWWGYEMLFGRAQMTAGTFVWRFGRAFICYTLIVSWATYQPLIVKPLLE
APDGMATIVCQSTGGSNCGGDGSSGSSVTQGLTDIWNSGLAVVKAMADAGGITAVGMYILAIVVLAVVCI
LCAIAVTLLMIGKMTMFILLAIGPIVLCCALFNLTSRVVDGWITSLAGYALLPIIVYVILGFMLTLLKGR
VDALTADASAANMTTLAPFMLMSIVTAFLLTHSISIALAIAGGGPRIDALGAAAGLMTARLAWRAAAGSG
RGVAQAGGYLFNQRPDGPATIGDGDPAAAQVRAAAANARK
 
Nucleotide Sequence: 963 bp     [Download]
>gi|222101962|ref|NC_011987.1|:48858-49820 Agrobacterium radiobacter K84 plasmid pAtK84c, complete sequence
ATGTATACGACGCTTGCCAGCTATCTGGGGCCGCTGTTCCTGGCGGCGCTCACCGTCTATGTGGTCTGGT
GGGGATACGAGATGCTGTTCGGCCGTGCCCAGATGACCGCGGGCACCTTCGTCTGGCGGTTTGGCCGGGC
GTTCATCTGCTACACCCTGATCGTCTCATGGGCCACCTATCAGCCATTGATCGTAAAACCCCTGCTGGAA
GCGCCGGATGGCATGGCGACCATCGTTTGCCAGTCGACTGGCGGCAGCAATTGTGGTGGAGACGGTAGCT
CCGGATCGTCCGTCACCCAAGGCCTGACCGATATCTGGAATAGCGGGCTTGCCGTGGTCAAGGCGATGGC
GGATGCAGGCGGCATCACGGCTGTCGGCATGTACATCCTTGCGATCGTCGTGCTGGCGGTCGTCTGCATT
CTCTGCGCCATCGCTGTCACGCTGCTGATGATCGGCAAGATGACCATGTTTATCCTGCTGGCGATCGGGC
CGATCGTCTTGTGTTGCGCGCTGTTCAATCTGACATCGCGGGTGGTGGACGGTTGGATCACCAGTCTCGC
CGGTTACGCGCTGCTGCCGATCATCGTCTACGTCATCCTGGGCTTTATGCTGACTCTGCTGAAGGGCAGG
GTCGATGCGCTGACTGCCGATGCCAGTGCTGCAAACATGACGACATTGGCTCCGTTCATGCTGATGTCGA
TCGTCACCGCCTTTCTCCTGACCCACTCGATCTCGATCGCACTGGCAATTGCCGGCGGGGGCCCAAGAAT
TGACGCACTCGGTGCAGCGGCAGGCTTGATGACGGCGAGGCTTGCCTGGAGAGCTGCCGCCGGTTCCGGG
CGAGGCGTCGCCCAGGCTGGCGGATATCTGTTCAATCAAAGGCCCGACGGCCCGGCGACGATCGGGGACG
GCGATCCCGCGGCAGCGCAGGTCCGCGCCGCCGCCGCAAATGCTCGCAAATAA
 Primer design