SecReT4
Protein ID: 222102018
T4SS name [ID]VirB [420]
Gene symbolavhB8a
Locus tagArad_12070
StrainAgrobacterium radiobacter K84
Repliconplasmid pAtK84c [GenBank: NC_011987] [Browse all T4SS(s) in this replicon]
Location [Strand]49854..50600 [+]
Producttype IV secretion protein
Component typeVirB8
UniProt IDB9JPS5
KEGG IDara:Arad_12070
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.6e-61, Aligned region: 31..239
Protein Sequence: 248 a.a.     [Download]
>gi|222102018|ref|YP_002546608.1| type IV secretion protein [Agrobacterium radiobacter K84]
MVKTDNAAAEFGTPARVTNSGVIDSRYYSEGERWERSVYRSVAMSRGVWRTVAVLLSIALAAAIGLLWML
LPLKSFDVVVLEVDKTTGYVEASRPLQERGDLTQNEAVTRANIVRFIRARETYDPKGLRDNFDLASLYST
GKAAADLANAYSGANLSNPVKVYGANTTVSVFVKSVIFLNDNTAAVRFSTTRSGTSGPTVTDHWVANVRF
KYTSEPMRNDWRFDNPLGFQVTEYRRDQETVTSGEDAQ
 
Nucleotide Sequence: 747 bp     [Download]
>gi|222101962|ref|NC_011987.1|:49854-50600 Agrobacterium radiobacter K84 plasmid pAtK84c, complete sequence
ATGGTGAAGACTGACAATGCGGCGGCCGAATTCGGTACGCCTGCCCGAGTGACGAATTCCGGCGTGATCG
ATTCCCGCTATTACAGCGAGGGCGAACGGTGGGAGCGCTCGGTCTATCGCTCGGTGGCCATGTCTCGCGG
CGTCTGGAGAACAGTTGCGGTGCTGCTGAGCATTGCTTTGGCGGCGGCGATCGGTCTTCTCTGGATGCTG
CTGCCGCTCAAATCCTTTGATGTCGTTGTGCTCGAGGTGGACAAGACGACGGGCTATGTCGAGGCAAGCC
GACCGCTGCAGGAGCGCGGCGACCTCACGCAGAATGAAGCCGTGACGCGGGCGAATATCGTGCGTTTCAT
TCGTGCCCGCGAAACTTATGACCCAAAAGGGCTGCGCGACAACTTCGACCTGGCGTCGCTGTATTCGACG
GGCAAAGCTGCGGCCGATCTGGCGAACGCCTATTCCGGCGCGAACCTGTCCAATCCCGTCAAGGTCTACG
GCGCCAACACGACGGTCAGTGTCTTCGTCAAGAGCGTGATTTTCCTGAACGACAATACGGCGGCTGTTCG
CTTCTCGACGACCCGCTCCGGCACATCAGGTCCGACAGTCACGGATCATTGGGTCGCCAATGTCCGCTTC
AAATATACCTCGGAGCCGATGCGAAACGACTGGCGCTTCGACAATCCTTTGGGGTTTCAGGTGACCGAAT
ATCGCCGCGATCAGGAAACCGTCACCTCTGGGGAGGATGCCCAGTGA
 Primer design