SecReT4
Protein ID: 222102019
T4SS name [ID]VirB [420]
Gene symbolavhB9a
Locus tagArad_12071
StrainAgrobacterium radiobacter K84
Repliconplasmid pAtK84c [GenBank: NC_011987] [Browse all T4SS(s) in this replicon]
Location [Strand]50642..51403 [+]
Producttype IV secretion protein
Component typeVirB9
UniProt IDB9JPS6
KEGG IDara:Arad_12071
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 7.4e-60, Aligned region: 20..231
Protein Sequence: 253 a.a.     [Download]
>gi|222102019|ref|YP_002546609.1| type IV secretion protein [Agrobacterium radiobacter K84]
MLARPPIVLAEVQPQSVRADARIRTVPFQKDNVVYLAGMMGVSTMIVFNEDEQIATVAMGDSLAWQAVPD
QSKRFLFIKPLQPDAQTNMNVVTSKRVYTFFLNGAKPGNTKTAVIKLRFSYPEDSLDANLLAAARQNAAM
PNVRAALANPGRINYDYGYKGAVDARPTSMFDDGTKTFFQFSGEVPAFFAVKSDGSESLVNYRREGDYIV
VDKVARQWTLRSGNVVTCVFNMKPPIGALKPANGKPQEISHGH
 
Nucleotide Sequence: 762 bp     [Download]
>gi|222101962|ref|NC_011987.1|:50642-51403 Agrobacterium radiobacter K84 plasmid pAtK84c, complete sequence
ATGCTTGCCCGCCCGCCGATCGTTTTGGCGGAAGTCCAGCCGCAATCGGTGAGGGCCGACGCCCGCATTC
GCACCGTACCGTTCCAGAAGGACAATGTCGTCTATCTCGCTGGCATGATGGGCGTGTCTACGATGATTGT
CTTCAACGAGGACGAACAGATCGCGACGGTTGCCATGGGTGACAGCCTCGCCTGGCAGGCAGTCCCGGAT
CAGTCGAAGCGCTTCCTGTTCATTAAGCCACTGCAGCCTGACGCGCAGACTAACATGAACGTCGTGACGT
CGAAGCGGGTCTATACGTTCTTTCTGAACGGAGCGAAGCCCGGCAACACGAAAACCGCCGTTATTAAACT
CCGCTTTTCCTATCCGGAGGATTCGCTAGATGCCAATCTGCTGGCGGCCGCCCGCCAGAATGCGGCCATG
CCGAACGTCCGCGCGGCTTTGGCAAACCCCGGCCGGATCAACTACGACTATGGCTATAAGGGCGCTGTCG
ATGCCAGGCCGACCTCGATGTTCGATGACGGCACGAAGACCTTCTTTCAATTCAGCGGAGAGGTTCCGGC
ATTCTTCGCCGTCAAATCCGATGGCAGCGAGTCTCTCGTCAACTACCGGCGCGAGGGCGACTACATCGTC
GTCGACAAGGTTGCCCGCCAATGGACCCTGCGGTCCGGCAATGTCGTGACCTGTGTCTTCAACATGAAGC
CCCCGATCGGCGCCCTGAAGCCGGCAAACGGTAAGCCGCAGGAGATCAGCCATGGCCATTGA
 Primer design