SecReT4
Protein ID: 222102020
T4SS name [ID]VirB [420]
Gene symbolavhB10a
Locus tagArad_12072
StrainAgrobacterium radiobacter K84
Repliconplasmid pAtK84c [GenBank: NC_011987] [Browse all T4SS(s) in this replicon]
Location [Strand]51393..52676 [+]
Producttype IV secretion protein
Component typeVirB10
UniProt IDB9JPS7
KEGG IDara:Arad_12072
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.5e-58, Aligned region: 209..398
Protein Sequence: 427 a.a.     [Download]
>gi|222102020|ref|YP_002546610.1| type IV secretion protein [Agrobacterium radiobacter K84]
MAIDFEEEARIVETVAKPADGRRGRLMPVLLASVALVVLAYAGYVSFIKPQAARKTDANEEFKTASHAAH
LNFDPENPSPPPSDNKLVLVPPTPTPTVVPPPQITAPVVMPPVIDEEAARRAAEEAERARKEEELRQARL
RSNMLVVDQSVRGESAASVVGAASAQNAGSGGSANASADEDPDRRFVQSVGSQDVETVTASRNDRIDALI
PQGVLIRGVLETAIQSDLPGMVRAVISTDVYSFDGRRVLLSKGTMLTGEYKSGMARGQTRILIVWTRALR
SDGTSVALGSYGTDDLGRSGLAGFVDKHYLERFGAAAVLSMVGGISSFVAGLNSDGSSSSGSSSSTSSDA
QTQAQQTLSQTMAEMANIALKDSINIPPTIYVDQGTQIMVFVRKDLDFSSLYPDPVKEAVNELRRARIRN
APSTSGQ
 
Nucleotide Sequence: 1284 bp     [Download]
>gi|222101962|ref|NC_011987.1|:51393-52676 Agrobacterium radiobacter K84 plasmid pAtK84c, complete sequence
ATGGCCATTGATTTCGAGGAAGAGGCGCGCATCGTCGAGACGGTCGCCAAGCCCGCAGATGGCCGGCGAG
GCAGGCTCATGCCGGTTTTGTTGGCCTCGGTTGCTCTGGTGGTGCTTGCCTATGCCGGCTATGTCAGTTT
CATCAAGCCACAGGCTGCCCGGAAGACGGATGCAAACGAGGAGTTCAAGACGGCGAGCCACGCCGCTCAC
CTGAACTTCGACCCGGAAAATCCATCTCCACCCCCTTCTGACAACAAGCTCGTTCTTGTGCCGCCAACAC
CCACTCCGACGGTGGTTCCGCCACCTCAGATTACCGCCCCTGTCGTCATGCCGCCGGTCATCGATGAGGA
GGCGGCACGGCGCGCTGCTGAAGAGGCGGAGCGGGCAAGGAAAGAAGAGGAGCTGCGCCAGGCCCGGCTC
CGCTCGAACATGCTGGTCGTCGATCAATCCGTCAGGGGCGAAAGTGCAGCTTCCGTTGTTGGTGCGGCAT
CTGCGCAAAATGCCGGCTCGGGTGGCAGTGCCAATGCCAGTGCCGACGAAGACCCGGACCGCAGGTTCGT
GCAGTCGGTGGGATCTCAGGACGTCGAGACGGTGACGGCCTCTCGCAACGATCGGATCGACGCGCTTATT
CCCCAGGGGGTATTGATCCGCGGTGTGCTCGAAACGGCGATCCAGTCCGATCTGCCGGGCATGGTCAGAG
CCGTGATCTCGACCGATGTCTATTCCTTCGATGGCCGGCGGGTCCTTTTGTCGAAAGGAACCATGCTGAC
AGGCGAGTATAAGAGCGGGATGGCGCGTGGTCAGACACGTATCCTGATCGTCTGGACGCGAGCGCTGCGA
AGCGACGGGACATCTGTCGCCCTCGGTTCCTACGGAACGGACGATCTCGGCCGCTCAGGCTTGGCCGGCT
TCGTCGACAAGCACTATCTCGAGCGTTTTGGTGCGGCCGCGGTGCTGAGCATGGTCGGAGGTATCTCCTC
CTTTGTTGCCGGCCTGAACAGTGATGGATCCAGCAGCTCAGGTTCGTCGTCCTCAACGAGCTCGGACGCG
CAGACCCAGGCACAGCAGACCCTTTCCCAGACCATGGCTGAGATGGCGAATATCGCGTTGAAGGATTCGA
TCAATATTCCGCCGACGATCTATGTCGACCAGGGCACTCAGATCATGGTGTTCGTCCGAAAGGATCTCGA
TTTCTCCTCATTATACCCTGACCCGGTGAAGGAAGCCGTCAATGAACTTCGTCGTGCCCGGATCAGGAAT
GCGCCCAGCACCTCCGGCCAATGA
 Primer design