SecReT4
Protein ID: 222102021
T4SS name [ID]VirB [420]
Gene symbolavhB11a
Locus tagArad_12073
StrainAgrobacterium radiobacter K84
Repliconplasmid pAtK84c [GenBank: NC_011987] [Browse all T4SS(s) in this replicon]
Location [Strand]52651..53763 [+]
Producttype IV secretion protein
Component typeVirB11
UniProt IDB9JPS8
KEGG IDara:Arad_12073
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.7e-76, Aligned region: 42..351
Protein Sequence: 370 a.a.     [Download]
>gi|222102021|ref|YP_002546611.1| type IV secretion protein [Agrobacterium radiobacter K84]
MRPAPPANDVTKSDVLRSEEPKSEDPKSLWDSLPIYVRQTAQPIRKWLEDPAVIEIMCNRPGEIWIESLN
SHHMSRYDVPALDERAITALAQMIAGTTQQSVNEETPLLSAAMPHGERFQAVLSPVAVLGGAFAIRKQVI
RDMTLDDYVELGGLDDVQVTGAGMAAGEELSDLEHGLITRLQDSSPKARREWLRFAVENRITMLISGGTS
SGKTTFFNGLLKDVPAWERLVSIEDTRELKPSQPNYLALVTSKGGQGRARTTMQECLEAALRLRPDRIFM
GEIRGAEAFSFLQAVNTGHPGSLSTLHADNPRGAYERLAMATMQAGLGLTKAELMEFVRFVVPVVIQVAR
DPATMKRGVREIYFSKWSSR
 
Nucleotide Sequence: 1113 bp     [Download]
>gi|222101962|ref|NC_011987.1|:52651-53763 Agrobacterium radiobacter K84 plasmid pAtK84c, complete sequence
ATGCGCCCAGCACCTCCGGCCAATGACGTGACAAAATCTGACGTGCTGAGATCAGAAGAGCCAAAGTCCG
AGGATCCAAAATCCCTTTGGGACAGCCTGCCCATCTATGTCAGGCAGACGGCCCAGCCGATCCGAAAGTG
GTTAGAGGATCCGGCTGTGATCGAGATTATGTGCAATCGGCCCGGAGAAATCTGGATCGAGAGCCTCAAT
AGCCACCATATGAGCCGGTACGACGTGCCGGCGCTCGATGAGCGGGCGATTACGGCGCTGGCGCAAATGA
TTGCTGGAACGACACAGCAAAGCGTCAACGAGGAGACGCCGCTTCTGTCTGCCGCCATGCCCCATGGCGA
GCGCTTCCAGGCGGTGCTGTCTCCGGTCGCGGTTTTGGGCGGCGCCTTTGCGATCCGCAAACAGGTCATC
CGCGATATGACGCTTGATGACTATGTAGAGCTCGGTGGTCTCGATGACGTCCAGGTCACCGGGGCCGGTA
TGGCGGCTGGTGAGGAATTGAGTGATCTCGAGCACGGACTGATCACGCGGCTGCAGGACTCGTCACCCAA
GGCTCGGCGCGAATGGCTGCGCTTTGCCGTCGAAAACCGCATCACAATGCTGATTTCTGGAGGGACCTCG
AGCGGCAAGACCACCTTCTTCAACGGTCTCCTGAAGGACGTGCCGGCATGGGAGCGCCTGGTGTCGATCG
AAGACACGCGCGAGCTTAAACCCTCGCAGCCGAATTATCTGGCGCTCGTTACCTCCAAGGGCGGGCAGGG
CAGGGCGCGGACCACGATGCAGGAATGCCTCGAGGCAGCGCTTCGTCTCCGTCCGGATCGCATCTTCATG
GGCGAGATCCGCGGTGCTGAAGCCTTCAGTTTCCTGCAGGCGGTCAATACCGGGCATCCGGGGTCGCTAT
CGACACTGCATGCCGATAATCCGCGCGGCGCCTATGAGCGCCTCGCCATGGCGACTATGCAGGCGGGGCT
TGGCCTCACCAAGGCGGAGCTGATGGAGTTCGTGCGCTTCGTCGTGCCCGTGGTCATTCAGGTGGCCCGC
GATCCCGCCACCATGAAGCGCGGCGTGCGCGAGATCTATTTCAGCAAATGGAGCAGTCGATGA
 Primer design