SecReT4
Protein ID: 222102022
T4SS name [ID]VirB [420]
Gene symbol-
Locus tagArad_12074
StrainAgrobacterium radiobacter K84
Repliconplasmid pAtK84c [GenBank: NC_011987] [Browse all T4SS(s) in this replicon]
Location [Strand]53760..56123 [+]
ProductTRAG protein
Component typeVirD4
UniProt IDB9JPS9
KEGG IDara:Arad_12074
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 4.8e-72, Aligned region: 132..554
TrwB_AAD_bind [PF10412], Evalue: 6e-26, Aligned region: 147..532
TraG-D_C [PF12696], Evalue: 3.1e-19, Aligned region: 400..519
Protein Sequence: 787 a.a.     [Download]
>gi|222102022|ref|YP_002546612.1| TRAG protein [Agrobacterium radiobacter K84]
MNRFEKVVALVAGPIVGAGAAFYTWSASYAAGSYLMLKSSTMWKSFAGGDVLMPAKQAWVYLGNPIVTKL
ISVATISTLALSAVVAVAITLAIKRPWQVRPPADGSRFATLKDLESAGLLGGAPGKSVLLGTFGKGRNAV
DVRYSGDSHFFVNGPSRSGKGRGFVMPNLLEYEGSVIVLDVKLENYTLTGPARMAMGQRCYVFAPGSAHS
HRWNPLDFVRDWPERSTDLINLAATLLPIGEKEEAYWKQTARGLLAGALGYVLESASMEGRRNLRSVLRL
LSTGRPFSAVLQEIIDNEPELDQFILGSFRQHLGRDEEQRPSFEGHVTTALAAFNNLLIAEACSGSDFDI
RSLRRKPFSLFIAAPVSDFGTVEPIIRLLIQQIHDVMLRSLPGADEPHKILMMLDEFYQFERLPEIIKRA
PLVAGYGLTIALVAQNIPQLDERYGQQTRNALLGNMDVKLSIAVGDDATAKIVSDNLGRKYVEREGWGRQ
TGLLFGKQASSGRFELVPLIDPGSVQRLDDSNTVLQVRGGYGAILNKLNFYGDIRFIARRREVEGWKSEL
VIPEIRIQTEWPLFAPQPPELAVELPAVQDEQRQSSDIDHEMIVLEHAGAVFVEPARLMHVYRSAISAVD
DQPTADLLFRLRTAPGTIGDIKGEKSRFVRQDRRAREQALASVWPLRKAISEARWAVIGARLSDRAEREE
LFFSRGINSIVADDLDAHEDETNHLHLGFSSAQAVIDQVTDVAEAAIGNEQNSDPNALAAALGNLKAALE
YSMTEFEEENRLPVSTW
 
Nucleotide Sequence: 2364 bp     [Download]
>gi|222101962|ref|NC_011987.1|:53760-56123 Agrobacterium radiobacter K84 plasmid pAtK84c, complete sequence
ATGAACCGCTTCGAGAAAGTCGTGGCTCTCGTCGCGGGACCGATCGTGGGCGCAGGTGCTGCCTTCTACA
CCTGGTCGGCGAGCTACGCGGCCGGCTCATATCTGATGCTGAAAAGCTCGACCATGTGGAAGAGTTTTGC
TGGCGGCGACGTGCTGATGCCGGCAAAGCAAGCTTGGGTTTATCTTGGCAATCCGATCGTCACGAAGTTG
ATTTCCGTTGCCACGATCTCGACGCTGGCATTAAGTGCCGTGGTCGCTGTTGCGATCACACTAGCGATCA
AGCGGCCCTGGCAGGTCCGTCCGCCAGCTGATGGCTCCCGCTTCGCGACTCTCAAGGATCTCGAGAGTGC
GGGGCTACTGGGCGGCGCACCTGGCAAGTCGGTGCTGCTCGGCACCTTCGGCAAGGGCCGCAATGCCGTC
GACGTCCGCTATAGCGGTGACAGCCATTTCTTCGTCAATGGCCCATCTCGCTCCGGCAAGGGCCGTGGCT
TCGTCATGCCGAACCTTCTCGAATACGAGGGATCGGTCATCGTGCTCGACGTCAAACTCGAAAACTACAC
GCTGACCGGACCCGCACGTATGGCGATGGGACAGCGGTGCTATGTCTTCGCGCCAGGATCTGCGCATTCA
CATCGTTGGAATCCGCTCGACTTCGTGCGCGATTGGCCGGAGCGATCAACGGATCTGATCAATCTGGCCG
CAACGCTGTTGCCGATCGGCGAGAAAGAGGAGGCCTATTGGAAGCAGACCGCCCGGGGGCTGCTTGCTGG
CGCTCTTGGATATGTGCTGGAGTCGGCGTCTATGGAGGGCAGGCGAAACTTGCGCTCCGTGCTGCGGCTG
CTTTCGACCGGCCGTCCGTTCTCGGCCGTGCTGCAAGAGATCATCGACAATGAACCGGAACTCGACCAGT
TTATTCTGGGGAGCTTTCGCCAGCACCTCGGGCGTGACGAGGAACAGCGGCCTTCATTCGAGGGCCATGT
GACCACGGCCCTTGCTGCGTTCAATAACCTCCTGATCGCCGAGGCTTGCTCGGGAAGTGATTTCGACATC
CGTAGCCTGCGTCGCAAGCCGTTCTCGTTGTTCATCGCAGCACCTGTCTCCGATTTCGGAACCGTCGAAC
CGATTATCCGGCTACTGATCCAGCAAATCCATGATGTGATGCTGCGATCGCTCCCTGGTGCCGATGAACC
GCACAAGATCCTGATGATGCTTGACGAGTTCTACCAGTTCGAGCGGCTGCCTGAAATCATTAAGCGGGCG
CCTCTGGTCGCTGGCTACGGACTGACGATCGCGCTCGTCGCCCAGAACATTCCGCAGCTCGATGAGCGGT
ACGGCCAGCAAACCCGGAATGCGCTTCTGGGCAACATGGACGTCAAGCTCAGCATCGCCGTTGGCGATGA
CGCTACGGCGAAAATCGTCTCCGACAATCTCGGTCGCAAATACGTGGAGCGTGAGGGCTGGGGGCGGCAG
ACTGGGCTTCTCTTTGGAAAGCAGGCATCGTCCGGCCGGTTTGAATTGGTGCCGCTGATTGATCCAGGTT
CGGTCCAGCGGCTGGATGACAGCAATACCGTCCTGCAGGTCCGCGGCGGCTATGGCGCCATCCTGAACAA
GCTGAACTTTTACGGCGATATCAGGTTTATAGCGCGACGACGGGAGGTTGAGGGATGGAAGAGCGAGCTT
GTCATTCCGGAGATCAGGATCCAGACCGAGTGGCCACTATTCGCGCCTCAGCCGCCGGAACTAGCCGTGG
AATTGCCAGCAGTTCAGGACGAACAGCGGCAATCTAGCGACATTGACCACGAGATGATCGTGTTGGAGCA
CGCCGGCGCCGTGTTCGTCGAGCCGGCGCGGCTCATGCATGTCTATCGATCGGCGATATCTGCAGTGGAT
GACCAGCCAACTGCCGATCTGTTGTTTCGACTGAGGACCGCGCCTGGAACGATCGGCGATATAAAAGGAG
AGAAAAGCCGCTTTGTTCGGCAGGACAGACGCGCAAGAGAGCAGGCGCTGGCGTCGGTCTGGCCGCTGCG
CAAGGCGATCTCTGAGGCGCGATGGGCTGTCATTGGCGCACGGCTCTCCGACAGGGCGGAGCGTGAGGAA
TTGTTTTTCTCGCGCGGCATCAATTCAATCGTGGCGGATGATCTTGATGCCCACGAGGACGAGACCAATC
ATCTGCACTTGGGGTTCTCATCGGCCCAGGCGGTCATAGATCAGGTCACGGACGTTGCGGAAGCCGCGAT
CGGCAATGAGCAGAATAGCGATCCGAACGCACTCGCGGCGGCTCTCGGCAATCTTAAGGCTGCTTTGGAG
TATTCCATGACGGAATTCGAAGAGGAGAACCGTCTACCAGTTTCCACCTGGTAA
 Primer design