SecReT4
Protein ID: 222102338
T4SS name [ID]VirB [786]
Gene symbolavhD4
Locus tagAvi_9810
StrainAgrobacterium vitis S4
Repliconplasmid pAtS4a [GenBank: NC_011986] [Browse all T4SS(s) in this replicon]
Location [Strand]10420..12519 [-]
Productconjugative coupling protein
Component typeVirD4
UniProt IDB9K5Y6
KEGG IDavi:Avi_9810
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.4e-89, Aligned region: 119..535
TrwB_AAD_bind [PF10412], Evalue: 3.2e-31, Aligned region: 127..518
TraG-D_C [PF12696], Evalue: 1.1e-28, Aligned region: 382..504
AAA_10 [PF12846], Evalue: 6.4e-06, Aligned region: 132..459
Protein Sequence: 699 a.a.     [Download]
>gi|222102338|ref|YP_002546479.1| conjugative coupling protein [Agrobacterium vitis S4]
MTKGFKAVYLAFCLAVAFAAWMLGYGAGLHLFYGDGRILDTTIRSNPFAPIQQFWAYSDNPTLQKVALGS
LVPAFVIAAITAYLGLRPVTSPLGDAAFQDIAGLRMGKWFGKKGHIFGGFGGKVLRAQDDRHHLIIGPTR
SGKGAGYVIPNALMHEGSMIVTDLKGEVFRATAGYRKKNGSQVFIFAPGSERTNSYNPLDFVRPERGNRT
TDIQNIASILVPENTESENSVWQAIAQNVIAGAISYMLESPFYHDRRNLGEINSFFNSGMDLQALMKHIK
EKEPYLSKFTVESFNSYISLSDRAAASALLDIQKAMRPFKNERVVAATNFTDMDLRAMKRRPITIYLAPN
ITDITLLRPLLTLFVQQVMNILTLEHDPNSVPVYFLLDEFRQLKRMDEIMTKLPYVAGYNIKLAFIIQDL
KNLDEIYGETSRHSLLGNCGYQLILGANDQATADYASRALGKRTIRYSSESRTIEIMGLPRRTKVEQIRE
RDLMMSQEVRQMPENRMILLVEGQRPIFAEKLRFFNTQPFKAAEAYAQAHIPSVPDIEYLPSKPVPATTA
EYENAGNVAPVAEPSAAVQTNIPEAGPAQKEPEKQIPAAEAPEPAQATAPAAPPAKRTVNPAALTSKTKA
TPAARPKAPKRNSSTSDDIARRKEIEALQSLAVQRLREQVEKASAGKNPTKRKNIMDVFAATVPDPETA
 
Nucleotide Sequence: 2100 bp     [Download]
>gi|222102329|ref|NC_011986.1|:c12519-10420 Agrobacterium vitis S4 plasmid pAtS4a, complete sequence
ATGACGAAGGGCTTCAAAGCCGTCTACCTAGCGTTTTGCCTCGCGGTTGCCTTTGCGGCCTGGATGCTTG
GATATGGCGCTGGCCTTCACCTTTTTTACGGCGATGGCAGGATCCTCGATACAACGATACGAAGCAATCC
TTTCGCGCCAATCCAACAGTTCTGGGCTTACAGCGATAATCCTACCCTGCAGAAGGTCGCCCTGGGGTCA
TTGGTGCCTGCCTTCGTGATCGCCGCAATTACTGCATATCTCGGCCTTAGGCCAGTCACGAGCCCATTAG
GGGACGCCGCGTTTCAGGACATCGCGGGTTTGCGGATGGGGAAATGGTTCGGCAAGAAGGGGCATATTTT
CGGTGGTTTTGGAGGCAAGGTCCTCCGGGCGCAGGACGATCGCCATCACCTGATCATCGGGCCGACAAGG
TCCGGTAAAGGTGCCGGTTACGTCATTCCGAATGCTCTCATGCATGAAGGCTCGATGATCGTTACCGACT
TGAAGGGCGAGGTCTTCAGGGCGACGGCCGGCTATCGGAAGAAGAATGGCAGCCAGGTCTTCATTTTCGC
GCCGGGGTCGGAGCGCACGAACAGCTACAATCCGCTCGATTTTGTGAGACCAGAACGGGGCAATCGAACA
ACCGACATTCAAAATATCGCCAGCATTCTTGTCCCGGAGAACACGGAGTCGGAAAACTCGGTATGGCAAG
CGATCGCGCAAAACGTCATTGCAGGCGCAATAAGCTACATGCTGGAAAGCCCATTCTACCACGACCGCCG
CAATCTTGGCGAAATCAACTCCTTCTTCAACAGCGGCATGGATCTCCAGGCTTTGATGAAGCACATCAAA
GAGAAAGAACCTTACCTCTCGAAGTTTACAGTCGAGAGTTTCAACTCATATATCTCATTGTCTGATCGAG
CCGCTGCATCAGCCCTTCTTGATATCCAGAAGGCTATGCGACCCTTCAAGAACGAACGCGTTGTCGCAGC
AACGAACTTCACCGACATGGACCTTCGTGCCATGAAGCGGCGGCCTATAACGATCTATCTCGCCCCGAAC
ATCACTGACATCACGCTTCTCAGGCCCTTGCTGACCCTGTTTGTCCAGCAGGTCATGAACATTCTCACGC
TCGAACACGATCCAAATTCTGTACCCGTCTATTTCCTCCTCGATGAGTTTCGCCAGCTGAAACGCATGGA
TGAGATCATGACGAAGCTGCCCTATGTGGCCGGTTACAACATCAAGCTCGCTTTCATCATTCAGGATCTT
AAAAACCTCGATGAGATATATGGGGAGACCTCGCGGCACTCGCTCTTGGGGAATTGCGGCTATCAGTTGA
TCCTTGGTGCAAATGATCAGGCCACGGCCGACTATGCGTCACGAGCTCTGGGCAAAAGGACCATTCGCTA
TTCCTCAGAGTCTCGCACCATAGAAATAATGGGACTTCCACGGCGAACGAAGGTCGAGCAAATTCGCGAG
CGAGACCTCATGATGTCTCAGGAGGTCCGGCAAATGCCGGAAAATAGAATGATCCTGCTGGTAGAGGGCC
AGCGTCCGATCTTTGCCGAAAAGCTTCGGTTCTTCAACACGCAGCCATTCAAAGCTGCTGAAGCCTATGC
CCAGGCTCACATCCCAAGCGTTCCGGATATTGAGTACCTTCCATCGAAGCCGGTCCCGGCGACGACTGCA
GAATATGAGAATGCGGGAAACGTAGCGCCGGTAGCTGAGCCTTCGGCTGCAGTCCAAACGAACATACCGG
AAGCCGGTCCCGCTCAGAAAGAACCGGAAAAGCAGATTCCTGCAGCGGAGGCGCCGGAGCCAGCGCAAGC
CACAGCGCCGGCCGCCCCTCCAGCGAAGCGCACCGTCAACCCCGCGGCGTTGACCTCGAAAACCAAAGCC
ACGCCCGCAGCCCGGCCGAAAGCCCCGAAGCGCAATAGCTCAACGTCAGATGACATCGCACGGCGAAAGG
AAATAGAAGCGCTGCAATCTCTTGCAGTACAAAGGCTTCGCGAACAGGTCGAGAAAGCCAGCGCCGGAAA
GAACCCGACGAAGCGGAAAAACATCATGGACGTTTTCGCTGCAACCGTTCCAGATCCAGAGACAGCCTGA
 Primer design