SecReT4
Protein ID: 222102339
T4SS name [ID]VirB [786]
Gene symbolavhB11
Locus tagAvi_9811
StrainAgrobacterium vitis S4
Repliconplasmid pAtS4a [GenBank: NC_011986] [Browse all T4SS(s) in this replicon]
Location [Strand]12516..13538 [-]
Producttype IV secretion protein AvhB11
Component typeVirB11
UniProt IDB9K5Y7
KEGG IDavi:Avi_9811
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.2e-83, Aligned region: 22..324
Protein Sequence: 340 a.a.     [Download]
>gi|222102339|ref|YP_002546480.1| type IV secretion protein AvhB11 [Agrobacterium vitis S4]
MNAPAGNPLVHDPHYFLTRSLEPIRPFLDDPKVVEIAINKPGHVYVERFGADHMEHHLIDVLTAQEIENI
GERVAASTKQFLNQANPILSAALPTGERIQVVLPPAAPDGGSITIRKQVVQNFSLEDYRDNGSLDKVSVA
VGGLSNVDRELIGYLRQEKIYDFIHTAITKRVSILISGGTSSGKTTFLNACLNSVDLNERILTLEDTREL
FPPQKNAVHLVASKGGQGTSNVTIQNLLESALRMRPDRLFVGEIRGAEAFSFLRAINTGHPGSMSTVHAD
TPMGAYEQLAMMMQQSGMSAGYSKQDLMSYIQMVIPIVIQLRREGGKRGVSEIFFARDEA
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|222102329|ref|NC_011986.1|:c13538-12516 Agrobacterium vitis S4 plasmid pAtS4a, complete sequence
GTGAACGCTCCAGCAGGTAACCCACTGGTTCATGATCCCCACTATTTCCTGACCCGTTCGTTGGAGCCCA
TCAGGCCATTTCTTGATGATCCAAAGGTTGTCGAAATCGCGATCAACAAGCCGGGCCACGTTTACGTGGA
ACGGTTTGGCGCGGACCATATGGAGCATCATCTTATCGATGTTCTGACCGCGCAAGAGATAGAGAACATC
GGAGAACGCGTCGCCGCCTCAACAAAGCAGTTCTTGAACCAGGCCAATCCAATCCTAAGCGCGGCGCTGC
CCACTGGTGAGCGCATTCAGGTCGTTTTACCGCCCGCGGCTCCTGACGGAGGATCCATTACCATCCGAAA
GCAGGTCGTCCAGAATTTCTCTCTGGAAGATTACAGGGACAACGGATCGCTCGATAAGGTGTCGGTTGCC
GTTGGAGGGTTGAGCAATGTCGATCGCGAGCTCATCGGGTATTTGCGCCAAGAAAAGATCTACGACTTCA
TCCATACTGCGATCACGAAGCGGGTTTCGATCCTTATCAGCGGCGGCACGTCCTCGGGCAAAACGACATT
CTTAAATGCCTGCCTCAACTCAGTTGACCTGAACGAGCGCATCTTGACGCTCGAAGACACGCGGGAACTT
TTTCCGCCACAGAAAAACGCAGTCCACTTGGTTGCTTCCAAAGGTGGGCAAGGTACGTCCAATGTGACCA
TTCAAAACCTGCTCGAGTCGGCACTGCGCATGCGTCCTGACCGCCTTTTCGTGGGCGAGATCAGAGGCGC
TGAAGCTTTCTCTTTCCTGCGCGCCATCAACACCGGTCATCCGGGTAGCATGTCCACAGTTCATGCAGAC
ACCCCTATGGGGGCATATGAGCAACTTGCAATGATGATGCAGCAATCCGGCATGTCGGCGGGCTACTCGA
AGCAGGACTTAATGTCCTACATTCAAATGGTGATTCCGATCGTCATCCAGCTCCGCCGCGAAGGAGGCAA
GCGCGGCGTTTCGGAGATTTTCTTTGCAAGAGATGAAGCATGA
 Primer design