SecReT4
Protein ID: 222102340
T4SS name [ID]VirB [786]
Gene symbolavhB10
Locus tagAvi_9812
StrainAgrobacterium vitis S4
Repliconplasmid pAtS4a [GenBank: NC_011986] [Browse all T4SS(s) in this replicon]
Location [Strand]13519..14727 [-]
Producttype IV secretion protein AvhB10
Component typeVirB10
UniProt IDB9K5Y8
KEGG IDavi:Avi_9812
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 8.1e-65, Aligned region: 193..380
Protein Sequence: 402 a.a.     [Download]
>gi|222102340|ref|YP_002546481.1| type IV secretion protein AvhB10 [Agrobacterium vitis S4]
MKRSPELEAMAQADETDVSNKNAKRNQTAGMAALVIFGVIAAYMVLATSKDEPRDNSQSDEEFRTTTFRP
PGFVRDGEPQPAPEQPVVVLPPPPPPPEPPADTTTFNVPPPPVAPPPTVEVPKVEEFPERFRSKLITMDQ
NLGGNGNGSLDGSASGPPLTVAGEDKNSQYLSSASAIGDRSAKARQLKRLDALVPEGTLIPGILETAIVS
DLPGQIRAITSQDVYSFDGRRVIIPTGTRLIGEYQSEVTRGQKRIFVVWTRLIRDDGASVRLNSIGADSL
GRSGLTGHVDNKFRERFGASILLSIVGGGASYLTGYGSEQSSGSNNDDAQRGADLARETIAQTFSDMANT
VLSENLRIPPTISVPQGERIFIFVRQDLDFSDMYDDPVTEAMKEIKRERSSR
 
Nucleotide Sequence: 1209 bp     [Download]
>gi|222102329|ref|NC_011986.1|:c14727-13519 Agrobacterium vitis S4 plasmid pAtS4a, complete sequence
ATGAAGCGCAGCCCCGAACTTGAAGCTATGGCGCAGGCTGACGAAACGGATGTCAGCAACAAGAACGCAA
AACGGAACCAGACGGCCGGAATGGCTGCTCTGGTGATTTTCGGCGTTATCGCCGCATACATGGTCCTTGC
GACCTCGAAAGATGAGCCGCGAGATAATTCCCAGTCAGATGAAGAGTTTCGCACCACGACGTTCCGGCCG
CCTGGCTTCGTGCGCGATGGTGAGCCGCAACCTGCCCCAGAACAGCCGGTCGTCGTCTTACCACCACCTC
CGCCGCCACCCGAGCCGCCAGCCGACACGACAACGTTTAACGTGCCGCCACCACCAGTGGCTCCGCCTCC
GACCGTGGAAGTACCCAAAGTGGAGGAGTTTCCCGAGCGCTTCAGGTCAAAGCTCATCACTATGGACCAG
AATTTGGGAGGCAACGGGAATGGTTCGCTGGACGGGTCGGCCAGCGGCCCGCCGTTGACGGTTGCCGGCG
AGGACAAGAATAGCCAATACCTCTCGTCCGCGAGCGCGATAGGAGATCGCAGCGCCAAGGCCAGACAGCT
GAAGCGCCTCGACGCTTTAGTGCCAGAAGGCACGCTTATTCCAGGCATTCTGGAAACGGCCATCGTGAGT
GATCTTCCCGGGCAGATCCGTGCTATTACATCTCAGGATGTCTACTCGTTCGACGGCCGGCGCGTGATCA
TCCCTACAGGCACGCGCCTAATTGGCGAATACCAGTCGGAGGTTACGCGTGGACAGAAGCGTATCTTCGT
CGTCTGGACACGCCTGATCCGTGACGATGGTGCCAGCGTGAGGCTAAACTCAATCGGAGCGGATAGCCTC
GGTCGATCAGGATTGACAGGTCACGTTGATAACAAGTTCCGGGAGCGTTTCGGTGCTTCCATCCTTCTTT
CGATCGTTGGTGGCGGCGCAAGCTATCTGACGGGATATGGAAGCGAACAGAGTTCAGGTTCCAACAATGA
TGATGCGCAGCGTGGGGCGGATCTCGCTCGCGAGACGATCGCGCAGACGTTTAGCGACATGGCAAACACC
GTGCTTTCAGAAAATCTTCGCATCCCCCCAACGATCAGCGTCCCACAGGGCGAACGCATCTTCATCTTCG
TGCGCCAAGACCTCGATTTCAGCGACATGTACGACGATCCGGTTACAGAAGCGATGAAGGAGATCAAACG
TGAACGCTCCAGCAGGTAA
 Primer design