SecReT4
Protein ID: 222102341
T4SS name [ID]VirB [786]
Gene symbolavhB9
Locus tagAvi_9813
StrainAgrobacterium vitis S4
Repliconplasmid pAtS4a [GenBank: NC_011986] [Browse all T4SS(s) in this replicon]
Location [Strand]14727..15536 [-]
Producttype IV secretion protein AvhB9
Component typeVirB9
UniProt IDB9K5Y9
KEGG IDavi:Avi_9813
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.7e-61, Aligned region: 31..239
Protein Sequence: 269 a.a.     [Download]
>gi|222102341|ref|YP_002546482.1| type IV secretion protein AvhB9 [Agrobacterium vitis S4]
MRVRLLFSAAFMAATMTHAFGAQQPRPGTLDSRVTSVVYQPNNVVKVSATYGISTMIIFDEDEKFETISL
GDTDSWQVAPSEKGNILFVKPIAKGVSTNMNVVTSKRIYFLELNDYAPTDERKVFGIRFVYPEKDLNASL
RKEAEFRAANPNVSNIDKANVNIDYSFSGDAALKPSMVFDDGKKTFFKFKGRVPAIFAVQSDFSETLRNF
RKEGEYIVVDGTATQYTLRDGNQWTCIFNLRKPDFAAPDPDIMAPKPDPDASKRRRSGN
 
Nucleotide Sequence: 810 bp     [Download]
>gi|222102329|ref|NC_011986.1|:c15536-14727 Agrobacterium vitis S4 plasmid pAtS4a, complete sequence
ATGAGAGTCAGACTACTTTTTTCAGCGGCCTTCATGGCCGCAACGATGACTCACGCCTTCGGCGCACAGC
AGCCTCGTCCGGGCACTTTGGATTCACGCGTCACAAGCGTCGTTTACCAGCCAAACAACGTGGTGAAGGT
CTCAGCGACTTACGGCATCTCAACGATGATCATCTTCGATGAAGATGAAAAGTTCGAGACGATCTCTCTT
GGCGACACCGACAGCTGGCAGGTCGCACCGTCTGAAAAAGGGAACATCCTTTTCGTAAAACCTATTGCGA
AGGGTGTTTCTACGAACATGAATGTCGTGACATCCAAGCGGATCTATTTCCTCGAATTAAATGACTACGC
GCCGACAGACGAACGTAAGGTCTTCGGAATCCGGTTTGTGTACCCCGAGAAGGACTTGAACGCATCTCTG
CGGAAAGAGGCGGAGTTTAGAGCCGCGAATCCGAACGTAAGCAATATCGACAAGGCCAATGTAAATATCG
ACTATTCATTTTCGGGTGATGCCGCTTTGAAGCCGTCTATGGTCTTCGATGACGGGAAAAAGACGTTCTT
TAAGTTCAAAGGGCGCGTACCAGCGATCTTTGCGGTTCAGTCCGACTTCTCTGAGACCCTTCGGAATTTC
AGAAAAGAGGGCGAATACATCGTCGTTGATGGCACGGCGACGCAATACACGCTGCGAGACGGGAACCAAT
GGACCTGCATTTTCAATCTACGCAAGCCCGATTTTGCAGCCCCTGACCCTGACATCATGGCTCCAAAACC
TGATCCGGACGCAAGCAAGCGCAGAAGGAGCGGCAACTAA
 Primer design