SecReT4
Protein ID: 222102342
T4SS name [ID]VirB [786]
Gene symbolavhB8
Locus tagAvi_9815
StrainAgrobacterium vitis S4
Repliconplasmid pAtS4a [GenBank: NC_011986] [Browse all T4SS(s) in this replicon]
Location [Strand]15533..16225 [-]
ProductType IV secretory pathway component VirB8
Component typeVirB8
UniProt IDB9K5Z0
KEGG IDavi:Avi_9815
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.4e-61, Aligned region: 16..222
Protein Sequence: 230 a.a.     [Download]
>gi|222102342|ref|YP_002546483.1| Type IV secretory pathway component VirB8 [Agrobacterium vitis S4]
MADSNEALRSYFQDGDKWEQEIVKKANRSRTFAWFIALIMSAITLMSLGTLVMLVPLKTFEPYIVEVDKN
TGYIEVKTGLTRSANLTDQQAVTQANVVRYIRSREGYDPFAIQQNFGIAALLSTADAAKELQDEWSAANP
NNPGRRLGRNKKITVDVKSVTFSNASTALVRFSTTESSESDNITRHYISVVRFRYTDTPERNDWRFENPL
GFQVYNYRRDQETVTPGAAG
 
Nucleotide Sequence: 693 bp     [Download]
>gi|222102329|ref|NC_011986.1|:c16225-15533 Agrobacterium vitis S4 plasmid pAtS4a, complete sequence
ATGGCAGATTCAAATGAAGCTCTCCGGAGCTATTTTCAAGACGGCGACAAGTGGGAACAGGAGATTGTAA
AAAAGGCAAATCGCTCAAGGACATTCGCTTGGTTTATCGCCCTGATAATGAGCGCCATCACCCTTATGTC
GCTCGGGACGCTGGTGATGTTGGTTCCGCTCAAGACCTTCGAGCCCTACATCGTCGAGGTCGATAAAAAT
ACAGGTTACATCGAGGTCAAGACCGGGCTCACGCGCTCGGCAAACCTCACTGACCAGCAGGCTGTCACTC
AGGCCAATGTTGTCCGGTACATCCGCTCACGCGAGGGCTATGACCCGTTTGCCATCCAGCAAAACTTTGG
AATTGCCGCGCTTCTTTCCACGGCCGATGCGGCCAAGGAGCTCCAAGACGAATGGAGCGCCGCTAATCCG
AACAACCCGGGCAGGCGTTTGGGCAGAAACAAGAAAATCACCGTTGACGTAAAGTCGGTCACGTTCTCGA
ACGCTAGCACTGCGCTCGTCCGGTTCTCGACAACGGAGAGTTCTGAAAGTGACAATATCACCCGGCACTA
CATCTCTGTTGTCCGCTTCCGTTATACGGACACACCGGAGCGCAACGATTGGCGGTTTGAAAACCCCCTT
GGCTTCCAGGTGTACAACTACCGTCGCGATCAGGAAACGGTTACGCCGGGAGCAGCAGGATGA
 Primer design