SecReT4
Protein ID: 222102343
T4SS name [ID]VirB [786]
Gene symbolavhB6
Locus tagAvi_9816
StrainAgrobacterium vitis S4
Repliconplasmid pAtS4a [GenBank: NC_011986] [Browse all T4SS(s) in this replicon]
Location [Strand]16261..17289 [-]
Producttype IV secretion protein AvhB6
Component typeVirB6
UniProt IDB9K5Z1
KEGG IDavi:Avi_9816
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 7e-46, Aligned region: 40..266
Protein Sequence: 342 a.a.     [Download]
>gi|222102343|ref|YP_002546484.1| type IV secretion protein AvhB6 [Agrobacterium vitis S4]
MEDFLGGLLDRIEQTGASFTQSAYGVVASEVTPLLTVLLIAYVAYYGLQLIMGTARVSVGEVISRVVRMT
LIVAFINSWGNFNTFFYAWLSDTPEDVGRAILAVSNTGITEPTNGLSMIWETANKAAGAFAEQAGYFSVL
PAMVGFLIMFGVGVFIAVALAILLLAKVMMWVLLGTAPIFIACLLFQPTRSYGMAWFQSVLMYAIIPLFV
YVVAAFLISAMDPELTKVAAAADQRRLQLDDVAAFLLLCAAGAFVLFNIQTLAQGITGGVAAGIGQVART
VGGLTGFSAPAAALTGARSVSGAAGRIGMAARERTHAGMRENIRNASADAMQKSISSNSVPR
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|222102329|ref|NC_011986.1|:c17289-16261 Agrobacterium vitis S4 plasmid pAtS4a, complete sequence
ATGGAGGATTTCCTCGGTGGGCTTTTGGATCGGATCGAACAGACGGGCGCTAGCTTTACGCAAAGCGCCT
ATGGGGTTGTTGCGAGCGAAGTAACGCCGCTTCTAACCGTGCTTTTGATTGCCTACGTCGCCTATTACGG
TCTTCAACTGATCATGGGAACTGCGCGTGTCAGCGTTGGGGAGGTGATCAGCCGCGTAGTCAGAATGACG
CTGATCGTTGCTTTCATAAACTCATGGGGTAACTTCAACACGTTCTTCTACGCCTGGCTGAGCGATACAC
CGGAAGACGTGGGACGGGCAATTCTCGCGGTCAGCAATACAGGTATCACAGAGCCGACAAACGGCCTTTC
GATGATCTGGGAAACGGCCAACAAGGCGGCGGGGGCCTTTGCTGAACAGGCCGGTTATTTTTCTGTTCTT
CCGGCTATGGTCGGTTTTCTGATCATGTTTGGCGTCGGCGTGTTTATCGCCGTCGCTCTTGCGATCCTTT
TGCTTGCGAAGGTCATGATGTGGGTGCTGCTAGGAACCGCCCCCATTTTCATCGCATGTTTGTTGTTTCA
ACCTACGCGAAGCTACGGAATGGCATGGTTCCAAAGTGTGCTGATGTACGCGATTATTCCGTTGTTCGTT
TACGTGGTTGCTGCGTTCTTGATCTCCGCAATGGATCCAGAGTTGACGAAAGTCGCTGCAGCGGCCGATC
AACGCAGGCTTCAACTCGATGATGTTGCAGCTTTCCTTCTTTTGTGTGCCGCCGGCGCCTTCGTGCTTTT
CAACATACAGACACTTGCTCAGGGGATTACGGGGGGTGTCGCAGCCGGGATCGGCCAAGTGGCGCGAACC
GTCGGAGGCCTGACGGGCTTCAGTGCCCCCGCTGCTGCACTCACAGGAGCGCGCAGTGTTTCCGGCGCAG
CCGGTCGGATCGGGATGGCTGCAAGGGAACGTACCCATGCGGGAATGCGGGAAAATATTCGAAATGCAAG
CGCGGACGCGATGCAGAAAAGCATCAGCAGTAACAGCGTGCCACGTTAA
 Primer design