SecReT4
Protein ID: 222102345
T4SS name [ID]VirB [786]
Gene symbol-
Locus tagAvi_9818
StrainAgrobacterium vitis S4
Repliconplasmid pAtS4a [GenBank: NC_011986] [Browse all T4SS(s) in this replicon]
Location [Strand]17522..18220 [-]
Producthypothetical protein
Component typeVirB5
UniProt IDB9K5Z3
KEGG IDavi:Avi_9818
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 7e-08, Aligned region: 20..203
Protein Sequence: 232 a.a.     [Download]
>gi|222102345|ref|YP_002546486.1| hypothetical protein Avi_9818 [Agrobacterium vitis S4]
MKKTIATAFSLALASTAYAQVPTIDNANLKVAQETSKTTTDILDTNKEVLKTVEETLKAVTGDRGSVQSP
MQNLAIGNGFSVSQMPSFDSLMSGGVPNFGNMGGDIGKIASTFINGLQLVKNLSGKADSTFSGDKSYEEV
MNTVLGVAALVTGSNQAVQQRTQSFQQAGQQIGKAEDIKGSIDQNTQLQVQSGLVLNEMIGVMNGTVQSL
NAQNQQRLVDMSNSKKAMTYGD
 
Nucleotide Sequence: 699 bp     [Download]
>gi|222102329|ref|NC_011986.1|:c18220-17522 Agrobacterium vitis S4 plasmid pAtS4a, complete sequence
ATGAAAAAGACGATCGCAACGGCGTTTTCGCTGGCTCTAGCTTCGACAGCGTACGCTCAGGTCCCCACAA
TCGACAATGCTAACCTGAAGGTTGCTCAGGAAACATCGAAAACAACGACCGACATCCTCGATACCAACAA
GGAGGTTCTTAAGACCGTCGAAGAAACACTTAAGGCCGTAACGGGTGACCGTGGAAGCGTGCAAAGCCCT
ATGCAGAACCTTGCTATCGGCAATGGCTTCAGTGTCTCCCAGATGCCGTCCTTCGACAGCTTGATGAGCG
GTGGCGTACCGAATTTCGGGAACATGGGGGGCGATATCGGCAAAATCGCCTCCACCTTTATCAACGGGCT
GCAGTTGGTGAAAAACCTGTCGGGAAAGGCCGATAGCACATTCTCAGGCGACAAGTCCTATGAGGAGGTG
ATGAACACGGTTCTCGGCGTTGCGGCTTTGGTGACCGGTTCAAACCAGGCGGTACAACAGCGTACCCAAT
CCTTCCAGCAAGCAGGTCAGCAGATTGGCAAGGCTGAGGATATCAAGGGCTCGATCGATCAGAATACGCA
GCTTCAGGTCCAATCCGGGCTGGTGCTAAACGAAATGATCGGCGTCATGAATGGCACAGTCCAGTCGCTC
AATGCTCAAAACCAGCAACGTCTTGTCGATATGTCGAACTCGAAGAAGGCGATGACCTACGGTGATTAA
 Primer design