SecReT4
Protein ID: 222102347
T4SS name [ID]VirB [786]
Gene symbolavhB4
Locus tagAvi_9821
StrainAgrobacterium vitis S4
Repliconplasmid pAtS4a [GenBank: NC_011986] [Browse all T4SS(s) in this replicon]
Location [Strand]19318..21777 [-]
Producttype IV secretion protein AvhB4
Component typeVirB4
UniProt IDB9K5Z5
KEGG IDavi:Avi_9821
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 2.7e-38, Aligned region: 206..407
AAA_10 [PF12846], Evalue: 1.9e-36, Aligned region: 461..743
Protein Sequence: 819 a.a.     [Download]
>gi|222102347|ref|YP_002546488.1| type IV secretion protein AvhB4 [Agrobacterium vitis S4]
MLKVIKEELGFGKVAGNERPMSVHIPYMRHVSDTVIGLENGSLASVIKLDGLFFQTEDQAELNMRSVVQN
TMIRALGSSRFSLWSTVIRREVETEIGGTFDQSFCDILNTRYMGQLRKKRMFTNEIYLTIVRSGMRGALG
VGDSLKRIFTQSNKDAKTQATREEVTDLEELIGNIVRELSKYGARSLGITYRKKSDDIAKIEGQEEETKG
EPYSEPCEFFNSILTGSVSRKMRLPRMGIRNFIGTSRLHFAKRAFHAQAAVDEDSRYGALLSIKEYPPFT
GPGMLDGLLQVNHEFILTQSFTLADKPIAQERITRLQRQIRASDEAGTSVESDINFALDSMLNQEAVFGF
HHFSLLCISRDLEGLSRCVSELGACLTDMNINWLREDLNLEAAFWAQLPGNHSYIARKAMLSSSNFSGLS
SMHNFASGQAERTHWGLPITILETTSQTPYWFNFHRRDIGHFTVTGPTGSGKTVGLSFLLAQAMRVSPTP
RAVFFDKDRGAEIFVRAIGGSYEILSPGTPTGFNPLQLENTGPNREFLQRLLKAMLGGRDRRDFTQEDED
IIERAVVRLMEEPAQQRNLTNLGNLLMGRARADANDLYSRLRPWTEGEKAWLFNAPHDVLSFSGRTVFGF
DMTSILGNEELRTPALMYLYHRLDELLDGNPVMFFMDEGWQLLLDETFSAFIVDKMKTIRKLNGIVGFGT
QSAADIAKSKVSHTLIEQSSTNIHFPNPRADEESYIKRFGLTVKEYNFIKNTPPEKRTFLIKHGNDSVIA
RLDLSSMPDLVKVLSGRKETIEECAALREQYGDEPENWLAKFCGWENAE
 
Nucleotide Sequence: 2460 bp     [Download]
>gi|222102329|ref|NC_011986.1|:c21777-19318 Agrobacterium vitis S4 plasmid pAtS4a, complete sequence
ATGCTGAAAGTCATCAAAGAAGAGCTAGGATTTGGGAAGGTCGCCGGAAACGAGCGGCCTATGTCCGTTC
ATATTCCCTACATGCGGCATGTCTCGGACACGGTGATAGGTCTCGAGAATGGATCACTCGCCAGTGTCAT
CAAGCTCGACGGCTTGTTTTTCCAGACCGAAGACCAGGCCGAATTGAATATGCGATCAGTCGTCCAGAAC
ACGATGATACGCGCGCTCGGCTCAAGCCGGTTTTCCCTATGGTCAACCGTGATCCGTCGCGAGGTCGAGA
CCGAGATCGGCGGAACGTTTGATCAATCATTCTGCGACATCCTGAATACGCGATACATGGGTCAGCTTCG
CAAGAAGCGCATGTTCACCAACGAGATCTACTTGACGATTGTCCGTTCGGGCATGCGCGGCGCGCTTGGT
GTTGGCGACTCTCTCAAGCGGATTTTTACGCAGTCCAACAAGGACGCCAAAACACAAGCCACGCGCGAAG
AGGTAACGGACCTAGAGGAACTGATCGGGAATATCGTCCGTGAACTGAGTAAATATGGAGCCCGCTCGCT
CGGCATAACCTATCGGAAGAAGTCCGATGATATTGCAAAGATCGAGGGGCAGGAGGAAGAGACCAAGGGC
GAACCGTATTCCGAGCCCTGCGAATTCTTCAATTCTATCCTCACGGGGAGTGTGTCTCGAAAGATGCGAC
TGCCGCGCATGGGCATTCGCAACTTCATTGGAACATCTCGTCTCCACTTCGCCAAGCGCGCCTTTCACGC
GCAAGCCGCCGTGGACGAAGATTCGCGGTATGGCGCACTGCTGTCCATCAAGGAATACCCTCCTTTCACT
GGACCTGGCATGTTGGACGGACTGTTACAGGTGAACCATGAGTTCATCCTGACGCAGTCATTTACCCTTG
CAGACAAGCCAATTGCGCAGGAGCGCATAACGCGCCTTCAGAGGCAAATCCGTGCCTCGGATGAAGCTGG
GACGTCTGTAGAATCTGACATCAATTTTGCTCTCGACAGTATGCTGAATCAGGAAGCCGTGTTTGGCTTC
CACCATTTTTCGCTACTTTGCATTTCCCGGGACCTCGAAGGCTTGAGCCGCTGCGTTTCGGAACTTGGTG
CATGCCTCACGGACATGAATATCAACTGGCTGCGTGAAGATCTCAATCTTGAGGCAGCGTTTTGGGCGCA
GTTGCCCGGTAACCATTCCTATATTGCTAGAAAGGCGATGCTCTCCAGCTCGAACTTCTCGGGCCTGTCA
TCAATGCACAATTTCGCCAGTGGTCAGGCGGAACGTACGCATTGGGGCCTTCCCATCACGATCCTTGAGA
CGACATCGCAGACGCCCTACTGGTTCAATTTCCACCGCCGCGATATCGGGCATTTTACCGTCACAGGACC
GACCGGCTCGGGTAAAACTGTCGGTTTGAGTTTCCTGCTCGCGCAGGCCATGCGAGTTTCCCCAACACCC
CGCGCCGTCTTTTTTGATAAGGACCGCGGAGCCGAAATCTTCGTTCGAGCCATCGGCGGATCTTACGAGA
TCCTTTCCCCGGGTACACCAACTGGATTCAATCCGCTCCAGTTGGAGAACACGGGACCAAACAGAGAATT
TCTTCAGCGCCTTCTCAAGGCGATGCTCGGTGGACGTGATCGCCGCGACTTCACCCAGGAAGATGAAGAT
ATCATAGAGCGCGCTGTGGTCCGCCTCATGGAAGAACCGGCACAACAGCGAAACCTCACCAACCTTGGCA
ACCTGCTTATGGGCCGTGCCCGTGCTGATGCCAATGACCTCTATTCTCGACTTCGTCCTTGGACCGAGGG
CGAAAAGGCTTGGCTCTTTAACGCTCCACACGATGTGCTGTCCTTCTCTGGCCGGACGGTGTTCGGCTTT
GACATGACCAGTATTCTTGGGAACGAAGAACTGCGGACGCCCGCCCTCATGTATCTCTACCATCGGCTTG
ATGAACTGCTGGATGGCAATCCGGTCATGTTCTTCATGGACGAAGGCTGGCAGCTGCTCCTCGATGAAAC
TTTCAGCGCGTTCATTGTCGACAAAATGAAGACCATTCGTAAGCTCAACGGCATCGTGGGCTTTGGCACT
CAATCGGCCGCCGACATTGCAAAGTCGAAGGTCTCTCACACGCTCATTGAGCAGTCTTCCACGAACATTC
ATTTCCCGAACCCGCGTGCAGACGAAGAGAGCTACATCAAGCGCTTCGGTCTCACGGTGAAGGAATACAA
CTTCATCAAGAACACCCCGCCCGAAAAGCGAACCTTCCTGATCAAGCACGGCAATGACTCAGTCATCGCC
CGGCTCGACCTTTCGAGCATGCCCGATCTCGTCAAGGTCCTGTCCGGGCGTAAGGAGACGATCGAGGAGT
GCGCCGCACTCCGCGAACAATATGGAGACGAGCCGGAAAACTGGTTGGCTAAATTTTGCGGATGGGAGAA
TGCTGAATGA
 Primer design