SecReT4
Protein ID: 222102348
T4SS name [ID]VirB [786]
Gene symbolavhB2
Locus tagAvi_9822
StrainAgrobacterium vitis S4
Repliconplasmid pAtS4a [GenBank: NC_011986] [Browse all T4SS(s) in this replicon]
Location [Strand]22081..22431 [-]
Producttype IV secrection system pilin protein
Component typeVirB2
UniProt IDB9K5Z6
KEGG IDavi:Avi_9822
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.4e-22, Aligned region: 11..107
Protein Sequence: 116 a.a.     [Download]
>gi|222102348|ref|YP_002546489.1| type IV secrection system pilin protein [Agrobacterium vitis S4]
MKKVKLGQSQAVKMIALLGVVAAVQIVGAELAFAQGAGGGGSGAFGPIQTAVQMIVDFITGPFGRLLAII
AVIALGFMAFAGRLSWFTAGAVVIGIGLVFGAPAIVDQMISSVGGQ
 
Nucleotide Sequence: 351 bp     [Download]
>gi|222102329|ref|NC_011986.1|:c22431-22081 Agrobacterium vitis S4 plasmid pAtS4a, complete sequence
ATGAAAAAGGTGAAGTTGGGTCAATCCCAGGCGGTTAAGATGATCGCGCTTCTTGGCGTGGTCGCGGCGG
TGCAGATCGTCGGCGCGGAGTTGGCGTTTGCCCAAGGGGCAGGCGGCGGAGGCAGTGGTGCTTTCGGCCC
TATCCAGACCGCCGTGCAGATGATCGTGGATTTCATCACTGGCCCATTTGGCCGGTTGTTGGCGATCATT
GCCGTTATCGCCCTGGGCTTCATGGCATTTGCCGGTCGTTTGTCTTGGTTTACAGCCGGCGCGGTCGTTA
TTGGTATCGGCCTCGTCTTCGGCGCTCCGGCCATTGTTGATCAGATGATTTCTTCGGTGGGCGGGCAGTA
A
 Primer design