SecReT4
Protein ID: 222102349
T4SS name [ID]VirB [786]
Gene symbolavhB1a
Locus tagAvi_9824
StrainAgrobacterium vitis S4
Repliconplasmid pAtS4a [GenBank: NC_011986] [Browse all T4SS(s) in this replicon]
Location [Strand]22444..23412 [-]
Producttype IV system transglycosylase
Component typeVirB1
UniProt IDB9K5Z7
KEGG IDavi:Avi_9824
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 5.7e-17, Aligned region: 164..254
Protein Sequence: 322 a.a.     [Download]
>gi|222102349|ref|YP_002546490.1| type IV system transglycosylase [Agrobacterium vitis S4]
MENRARMAGFSGTTVLLGTALVALWSANFAYAQDAVKNTRIASAYNGSEASGSPSLATNFAERWAGEAVP
AKEFVLGADGVVKDANKQNSTTETAASPDTNIGATETPYVDVTGSIGGSPTASRATGSLSQIGAGNVLAS
PVMGAKECGASPMTPDEIKALVVETARRHQVDEGFAVAITWAESRFDVVRNSPKGARGPMQLIPDTATRF
GVVDICDPRQNIEGGIKYLRFLLDEFQNPLLVAAAYNSGENRIYEYGGVPPFQETVGYVAKVLNFQLGLP
MPVGKRKAGNVVREAAATNTANGSGVIAVEKTGKFVGGVMHF
 
Nucleotide Sequence: 969 bp     [Download]
>gi|222102329|ref|NC_011986.1|:c23412-22444 Agrobacterium vitis S4 plasmid pAtS4a, complete sequence
ATGGAAAACAGGGCTCGCATGGCAGGCTTTTCAGGCACCACCGTCCTTTTGGGGACAGCTCTCGTCGCGC
TGTGGTCGGCCAACTTTGCATATGCCCAAGATGCTGTAAAAAATACCAGAATAGCTAGCGCATACAATGG
AAGCGAAGCGTCTGGATCACCGTCACTTGCAACCAATTTCGCTGAAAGATGGGCTGGCGAGGCTGTTCCA
GCGAAAGAATTTGTCTTGGGCGCTGATGGCGTAGTGAAGGACGCGAACAAGCAAAACAGCACGACCGAGA
CTGCGGCTTCACCAGATACTAATATTGGCGCAACAGAAACGCCGTATGTGGATGTGACAGGATCAATAGG
CGGCTCTCCGACTGCTTCTCGTGCGACCGGTTCACTTAGCCAAATTGGCGCAGGAAACGTGTTAGCTTCG
CCCGTAATGGGGGCAAAAGAGTGTGGCGCATCTCCGATGACGCCGGACGAGATCAAAGCTTTGGTTGTAG
AGACCGCGCGCCGCCATCAGGTTGATGAGGGGTTTGCTGTGGCAATCACTTGGGCCGAAAGCAGGTTTGA
CGTGGTTCGCAACTCTCCCAAAGGAGCTCGTGGCCCCATGCAGCTTATCCCCGATACCGCAACGAGGTTC
GGCGTCGTTGATATCTGCGATCCACGGCAGAACATCGAGGGTGGCATCAAGTATCTCCGGTTTCTGCTCG
ATGAGTTTCAAAATCCTCTGCTCGTAGCCGCTGCATACAACAGCGGCGAGAACCGGATCTACGAATATGG
CGGCGTTCCGCCCTTTCAGGAGACGGTCGGGTACGTAGCAAAAGTCCTCAATTTTCAGCTTGGTCTTCCG
ATGCCTGTGGGCAAGCGGAAGGCCGGAAATGTCGTCCGTGAGGCAGCGGCGACGAATACGGCCAACGGTA
GCGGGGTAATTGCCGTTGAGAAAACCGGCAAGTTTGTCGGTGGCGTGATGCACTTCTAA
 Primer design