SecReT4
Protein ID: 222109058
T4SS name [ID]Trb [253]
Gene symboltrbG
Locus tagArad_14169
StrainAgrobacterium radiobacter K84
Repliconplasmid pAtK84b [GenBank: NC_011990] [Browse all T4SS(s) in this replicon]
Location [Strand]121002..121892 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDB9JPG1
KEGG IDara:Arad_14169
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.5e-60, Aligned region: 80..293
Protein Sequence: 296 a.a.     [Download]
>gi|222109058|ref|YP_002551324.1| conjugal transfer protein TrbG [Agrobacterium radiobacter K84]
MDRAALKGMAPNMNIRLRRFPARLAAAAIVAAIVPLPTSLSSRALAADGVTANEAKGMGISTQWRDSRGL
VTKGPDGKVIFLYGEVQPSVVCSPLQVCDIELQGGEVVRDVLVGDTVRWKVEPATSGAAGGQAIHLIVKP
SESNLVTSMVVTTSRRTYHIQLKSHQTQYMARVGFEYPEDVSIKLADINARMEASTIPGAGVPAEQLNFA
YSVSGNAGWRPTRVYSDGEKTYVQFPRTISGQDAPVLFVVSGGQNRIVNYRMKGDMMVVDYHVDRAVLVS
GVGWRQEKVTIRRGGR
 
Nucleotide Sequence: 891 bp     [Download]
>gi|222108940|ref|NC_011990.1|:c121892-121002 Agrobacterium radiobacter K84 plasmid pAtK84b, complete sequence
CTGGACCGCGCAGCTTTGAAAGGCATGGCCCCGAACATGAACATTCGACTGAGACGTTTTCCGGCCAGGC
TGGCTGCCGCCGCGATCGTTGCCGCAATCGTGCCGTTGCCGACTTCTCTTTCCTCCCGCGCGCTCGCAGC
TGATGGCGTCACCGCCAATGAAGCGAAGGGGATGGGGATTTCCACCCAGTGGCGCGACTCACGCGGGCTT
GTCACGAAAGGACCGGACGGGAAGGTGATCTTCCTCTATGGCGAAGTGCAGCCCTCCGTCGTCTGCTCAC
CTTTGCAGGTCTGCGACATCGAGCTCCAGGGCGGCGAGGTCGTTCGCGACGTACTCGTCGGCGACACCGT
TAGGTGGAAGGTTGAGCCCGCAACATCGGGAGCGGCAGGAGGGCAGGCGATCCACCTGATCGTCAAGCCA
TCGGAGTCCAACCTTGTCACCTCGATGGTGGTGACCACCTCGCGTCGCACCTACCATATCCAGCTCAAGT
CGCACCAGACACAATACATGGCACGTGTTGGCTTCGAATATCCGGAAGACGTGTCCATCAAGCTCGCTGA
CATCAACGCGCGGATGGAAGCCAGCACCATTCCCGGCGCCGGCGTTCCCGCCGAGCAACTGAATTTTGCC
TATTCTGTATCGGGCAATGCAGGGTGGCGGCCGACGCGCGTCTATTCGGACGGGGAGAAGACTTACGTCC
AGTTCCCGCGCACGATCTCCGGCCAGGATGCGCCCGTGCTGTTTGTCGTCTCCGGTGGTCAGAACCGCAT
CGTCAACTATCGGATGAAGGGCGACATGATGGTGGTCGACTACCACGTCGACCGCGCGGTCCTGGTCTCC
GGCGTCGGCTGGAGACAGGAGAAGGTGACGATCCGGCGGGGAGGGCGGTGA
 Primer design