SecReT4
Protein ID: 222109060
T4SS name [ID]Trb [253]
Gene symboltrbL
Locus tagArad_14172
StrainAgrobacterium radiobacter K84
Repliconplasmid pAtK84b [GenBank: NC_011990] [Browse all T4SS(s) in this replicon]
Location [Strand]122551..123747 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDB9JPG3
KEGG IDara:Arad_14172
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3e-30, Aligned region: 67..279
Protein Sequence: 398 a.a.     [Download]
>gi|222109060|ref|YP_002551326.1| conjugal transfer protein TrbL [Agrobacterium radiobacter K84]
MVVVRPSRKLETAFIVIAILALATAPTLAQQGSVLTTLENQVVTAAKGWETTIMNAARSLFWILAGIEIG
IAAVWLAINAASLDAWFAELVRRIMFIGLFAFILDRGPALAKAVVDSLFQIGAGGGSASPANIFDAGIRV
ASKMSEQAKFGLWEDNALAIAAVFAMIVVVVAFSLVAAIFVAVMVEMYVGLLAGMIMLGLGGSSYTKDFA
VRYLVYAFSVGMKLMALVMIAKIGSDILIGLAEAPTATSDQFITTIGIAGISVVVFIIAMYVPPIIQGVV
QGASVSGGMEAIRHGGQTAAFAAGGAFLGAGAAMKGAESASSARAGGSSMAGAALRGMASGIGNAGWAAS
SAAREKAIASPGAYAGSLLGLANAKLDQTRQSGRPSAPPPPPPVNENK
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|222108940|ref|NC_011990.1|:c123747-122551 Agrobacterium radiobacter K84 plasmid pAtK84b, complete sequence
ATGGTAGTCGTCCGCCCGTCCCGCAAGCTCGAAACCGCTTTCATCGTCATCGCGATCCTGGCTCTTGCGA
CAGCGCCGACGCTCGCACAGCAAGGTTCCGTGCTCACCACGTTGGAGAACCAGGTCGTCACCGCCGCCAA
GGGCTGGGAGACGACGATCATGAACGCGGCACGGTCCCTGTTCTGGATCCTCGCGGGGATCGAGATCGGT
ATTGCTGCCGTGTGGCTGGCTATCAATGCGGCAAGCCTCGACGCGTGGTTCGCCGAGCTCGTGCGTCGGA
TCATGTTCATCGGTCTCTTCGCCTTCATCCTCGATCGCGGCCCGGCGCTCGCGAAGGCGGTGGTGGACAG
CCTGTTCCAGATCGGCGCCGGCGGGGGCTCCGCGTCGCCGGCCAACATCTTCGATGCGGGTATCCGCGTA
GCCTCCAAAATGTCGGAACAGGCGAAGTTCGGGCTGTGGGAGGACAACGCACTGGCGATCGCCGCGGTCT
TCGCGATGATCGTTGTCGTCGTCGCTTTCAGCCTCGTCGCCGCGATCTTTGTCGCCGTCATGGTCGAGAT
GTATGTGGGCCTCCTCGCCGGCATGATCATGCTCGGCTTGGGTGGCAGCTCCTATACCAAGGATTTCGCG
GTCCGTTACCTTGTCTATGCCTTCTCGGTCGGCATGAAGCTGATGGCGTTGGTGATGATCGCGAAGATCG
GATCCGACATTCTGATAGGGCTGGCCGAGGCGCCGACGGCGACCTCCGACCAGTTCATCACCACGATCGG
CATCGCCGGCATCTCCGTTGTGGTTTTCATCATCGCTATGTATGTGCCGCCGATCATCCAGGGCGTCGTG
CAGGGCGCATCGGTCTCAGGCGGCATGGAGGCGATCCGCCATGGTGGTCAGACGGCCGCCTTCGCCGCCG
GTGGCGCCTTCCTTGGCGCGGGCGCCGCGATGAAGGGGGCAGAATCAGCGAGCTCGGCGAGGGCAGGGGG
ATCGTCGATGGCGGGAGCAGCCCTTCGCGGCATGGCGTCCGGCATCGGCAACGCCGGATGGGCGGCAAGC
TCTGCGGCACGAGAAAAGGCGATCGCTTCGCCCGGCGCCTATGCCGGCTCTCTGCTCGGCCTCGCCAATG
CCAAGCTTGATCAGACCCGGCAATCCGGCAGGCCCTCGGCGCCTCCTCCGCCTCCACCCGTCAACGAAAA
CAAGTAA
 Primer design