SecReT4
Protein ID: 222109065
T4SS name [ID]Trb [253]
Gene symboltrbC
Locus tagArad_14179
StrainAgrobacterium radiobacter K84
Repliconplasmid pAtK84b [GenBank: NC_011990] [Browse all T4SS(s) in this replicon]
Location [Strand]127508..127915 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDB9JPG8
KEGG IDara:Arad_14179
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.7e-20, Aligned region: 5..101
Protein Sequence: 135 a.a.     [Download]
>gi|222109065|ref|YP_002551331.1| conjugal transfer protein TrbC [Agrobacterium radiobacter K84]
MSRKTQITLALAALAAFSWISIVNPAFASSGGGGLPWESPLQQIQQSITGPVAGFIALAAVAIAGAMLIF
GGELNDFARRLCYVALVGGVLLGATQIVALFGATGASIGEFEGRAGSWNVELSSELRTEGEGAHG
 
Nucleotide Sequence: 408 bp     [Download]
>gi|222108940|ref|NC_011990.1|:c127915-127508 Agrobacterium radiobacter K84 plasmid pAtK84b, complete sequence
ATGTCGCGTAAGACCCAAATCACCCTTGCGCTTGCAGCGCTAGCCGCCTTCTCCTGGATCAGCATTGTCA
ATCCGGCGTTCGCCTCTTCGGGCGGGGGTGGGTTGCCGTGGGAATCTCCGCTGCAACAGATCCAACAGTC
GATCACGGGACCGGTGGCTGGATTCATCGCACTCGCAGCGGTGGCGATCGCCGGTGCCATGCTGATCTTC
GGGGGAGAACTGAACGACTTCGCCAGGAGGCTTTGTTACGTCGCCCTTGTTGGCGGCGTGTTACTCGGCG
CGACCCAGATCGTCGCTCTCTTCGGTGCGACGGGCGCTTCGATCGGCGAGTTTGAGGGGCGAGCCGGATC
TTGGAATGTCGAACTGTCTTCGGAGCTTCGAACGGAAGGGGAGGGGGCTCATGGCTGA
 Primer design