SecReT4
Protein ID: 222109215
T4SS name [ID]Trb [320]
Gene symboltrbG
Locus tagAvi_9650
StrainAgrobacterium vitis S4
Repliconplasmid pAtS4b [GenBank: NC_011991] [Browse all T4SS(s) in this replicon]
Location [Strand]119879..120700 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDB9K3A6
KEGG IDavi:Avi_9650
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.6e-59, Aligned region: 58..272
Protein Sequence: 273 a.a.     [Download]
>gi|222109215|ref|YP_002551480.1| P-type conjugative transfer protein TrbG [Agrobacterium vitis S4]
MFKLTKLRASVVTALVLLTAAPTLGGAADYNASKGTRLSGQWQDAGAVMTRGPDGQVIYLFGETQPTVVC
APLQLCEVQLQPGEAVRDVLVGDTVRWQVEPASSGSPQGQRISLIVKPAEAGLKTSMVITTSRRTYHINL
QSDGTRYMARVAFKYPEDVRQQLAAVNQKISDSIIPGAGIPAENLRFDFSMRGSARWKPTRIYTDGTKTY
IQFPGQMRSGDAPVLYVVSGGQNQIVNYRLNNNMMVVDYLIDRAVLISGVGRQQQKITISRRG
 
Nucleotide Sequence: 822 bp     [Download]
>gi|222109117|ref|NC_011991.1|:c120700-119879 Agrobacterium vitis S4 plasmid pAtS4b, complete sequence
ATGTTCAAATTGACGAAATTGCGTGCGAGCGTTGTGACCGCACTGGTCCTTTTGACTGCCGCGCCCACCC
TGGGCGGTGCTGCCGACTACAACGCAAGCAAGGGCACCCGGCTTTCAGGCCAATGGCAGGACGCCGGCGC
TGTCATGACACGCGGACCTGACGGACAGGTCATCTATCTGTTTGGCGAAACGCAGCCGACCGTCGTCTGC
GCACCCTTGCAGCTTTGTGAGGTGCAGCTGCAGCCCGGAGAGGCCGTGCGCGATGTTCTCGTCGGTGACA
CTGTTCGATGGCAGGTTGAGCCCGCGTCGTCTGGTTCGCCGCAGGGACAGCGTATCAGCCTGATCGTCAA
GCCTGCCGAAGCCGGTTTGAAGACTTCGATGGTCATTACGACGTCACGCCGGACCTATCATATCAATCTG
CAGTCCGACGGCACACGCTATATGGCGCGCGTCGCCTTCAAATACCCCGAAGACGTTCGCCAGCAGCTAG
CGGCGGTAAACCAGAAGATCTCGGATAGCATCATTCCGGGTGCTGGCATTCCAGCCGAAAACCTCCGTTT
TGATTTTTCCATGCGCGGCTCCGCCCGCTGGAAACCAACCCGGATCTATACCGACGGGACGAAGACGTAC
ATTCAGTTCCCCGGCCAAATGAGAAGTGGCGATGCCCCAGTCCTCTATGTCGTGTCCGGAGGACAGAACC
AGATCGTCAACTACCGACTGAACAACAACATGATGGTGGTCGATTATCTAATCGATCGGGCCGTTCTGAT
TTCGGGCGTCGGTCGGCAGCAGCAGAAAATCACCATCAGCAGGAGGGGTTAA
 Primer design