SecReT4
Protein ID: 222109217
T4SS name [ID]Trb [320]
Gene symboltrbL
Locus tagAvi_9653
StrainAgrobacterium vitis S4
Repliconplasmid pAtS4b [GenBank: NC_011991] [Browse all T4SS(s) in this replicon]
Location [Strand]121425..122531 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDB9K3A8
KEGG IDavi:Avi_9653
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 6.5e-29, Aligned region: 65..274
Protein Sequence: 368 a.a.     [Download]
>gi|222109217|ref|YP_002551482.1| P-type conjugative transfer protein TrbL [Agrobacterium vitis S4]
MRAALVLRLAPFAIVALAAVEPALAADGSILTNLENNVRSATQGWQDTVMNAARSLFWILAGIEFGIAAV
WFAIAAPSLDTWVAELIRRIIFIGFFLFVLQQGPDFAKAVVDSLFQLGANGGTASPADVFNAGIKVASTL
SEKVKFGIFEDNAMAIGIIIAMIVVVISFSLVAAIFVSVLVEMYVGLLAGMIMLGLGGSSFTKDFAIKYL
VYAFSVGMKLMALVMIARIGSEILIGLSNDANTGEELLASLVIAGLSVVIFMIAIYVPNIIQGVVQGVSV
SSGMEAMRSSAQVTAFAASTVAGVGAGVAAAGTAKAAGAGILGQASAGVRAGGSALAGTAAKAAMGSHGS
GAGGPSRSMGLRNHKTSK
 
Nucleotide Sequence: 1107 bp     [Download]
>gi|222109117|ref|NC_011991.1|:c122531-121425 Agrobacterium vitis S4 plasmid pAtS4b, complete sequence
ATGCGTGCAGCACTGGTTTTGAGATTGGCGCCTTTCGCCATCGTCGCACTCGCCGCGGTGGAACCCGCCC
TGGCAGCGGATGGATCGATCCTTACAAACCTGGAAAACAATGTCCGCTCGGCCACTCAAGGGTGGCAAGA
CACCGTCATGAATGCGGCAAGGTCACTGTTCTGGATCCTGGCGGGAATAGAATTTGGTATTGCCGCCGTG
TGGTTCGCCATTGCAGCGCCATCGCTCGATACGTGGGTCGCAGAGCTGATACGGCGTATTATCTTCATCG
GCTTTTTCCTGTTTGTCCTGCAGCAGGGACCCGACTTCGCGAAAGCTGTCGTCGACAGTCTGTTTCAGCT
GGGGGCGAACGGCGGGACGGCTTCGCCAGCGGATGTCTTCAATGCCGGCATCAAGGTGGCGAGCACCCTG
TCGGAAAAGGTCAAGTTCGGCATTTTCGAAGACAACGCAATGGCGATTGGCATCATCATCGCCATGATTG
TCGTGGTGATCTCTTTCTCGCTCGTGGCCGCGATTTTCGTTTCGGTGCTGGTGGAGATGTATGTCGGCCT
GCTCGCCGGCATGATCATGCTCGGACTCGGCGGGTCGAGCTTCACCAAGGACTTCGCGATCAAATATCTC
GTCTATGCCTTCTCGGTGGGCATGAAGCTGATGGCGCTCGTGATGATCGCGCGCATCGGCTCGGAGATCC
TGATCGGCCTTTCGAACGATGCCAACACTGGAGAAGAACTGCTTGCGAGCCTCGTCATCGCGGGCCTGTC
CGTCGTCATCTTCATGATTGCGATCTACGTGCCGAATATCATCCAGGGCGTCGTACAGGGCGTGTCGGTC
AGCAGCGGCATGGAAGCCATGAGATCCAGCGCACAGGTCACTGCTTTTGCGGCTTCGACGGTCGCGGGTG
TCGGCGCTGGCGTCGCAGCGGCAGGTACTGCCAAGGCCGCCGGCGCTGGCATTCTGGGTCAGGCCTCCGC
GGGCGTGAGGGCAGGCGGCTCGGCTTTAGCCGGAACGGCAGCAAAAGCCGCCATGGGTTCGCATGGCTCG
GGCGCGGGCGGCCCATCGAGGTCGATGGGACTGCGCAACCACAAAACATCGAAATAG
 Primer design