SecReT4
Protein ID: 222109221
T4SS name [ID]Trb [320]
Gene symboltrbC
Locus tagAvi_9659
StrainAgrobacterium vitis S4
Repliconplasmid pAtS4b [GenBank: NC_011991] [Browse all T4SS(s) in this replicon]
Location [Strand]126301..126666 [-]
Productconjugal transfer protein
Component typeTrbC
UniProt IDB9K3B2
KEGG IDavi:Avi_9659
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.3e-22, Aligned region: 2..97
Protein Sequence: 121 a.a.     [Download]
>gi|222109221|ref|YP_002551486.1| conjugal transfer protein [Agrobacterium vitis S4]
MSRRMFTLVALAAISMMMAEPAFAAGGGGGLPWEGPLQQIQQSITGPVAMAIALIAVAVAGGMLIFGGEI
NDFARRLAYVVLVCGILLGATQVVGLFGGGGASIGVPLEATQDVTLDRAHG
 
Nucleotide Sequence: 366 bp     [Download]
>gi|222109117|ref|NC_011991.1|:c126666-126301 Agrobacterium vitis S4 plasmid pAtS4b, complete sequence
ATGTCGCGTAGAATGTTTACGTTGGTCGCCCTTGCGGCCATCTCGATGATGATGGCCGAACCGGCCTTTG
CTGCCGGGGGAGGGGGTGGTCTGCCCTGGGAGGGACCGCTTCAACAGATCCAGCAGTCCATCACCGGCCC
CGTCGCCATGGCAATCGCCCTGATCGCAGTCGCGGTCGCAGGTGGCATGCTCATCTTTGGTGGCGAGATC
AACGACTTCGCGCGTCGTCTCGCCTACGTCGTTCTTGTCTGCGGTATCCTTCTTGGCGCGACACAGGTTG
TCGGCCTGTTCGGCGGGGGAGGGGCGTCGATTGGCGTTCCTCTCGAGGCAACGCAGGACGTGACGCTGGA
CAGGGCGCATGGCTGA
 Primer design