SecReT4
Protein ID: 222110372
T4SS name [ID]Tfc [758]
Gene symbol-
Locus tagDtpsy_1164
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]1226605..1228584 [-]
Producthypothetical protein
Component typeTfc16
UniProt IDB9MG45
KEGG IDdia:Dtpsy_1164
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1.5e-68, Aligned region: 61..338
AAA_10 [PF12846], Evalue: 3.1e-12, Aligned region: 532..607
Protein Sequence: 659 a.a.     [Download]
>gi|222110372|ref|YP_002552636.1| hypothetical protein Dtpsy_1164 [Acidovorax ebreus TPSY]
MRWELPWPKLAASGTGDEEKPDGWQRHVEALRQAGVPEPGAAVQGRRPATVADEQALYDVAPSFAELLPW
VEFLPQSKSMLLEDGQSVAAFYELVPLGTEGREPGWLAHARDALENALQDSFDELDENPWVLQLYAQDEP
SFDQYMQTLRDYVQPRARGTAFTEFYLRFFGHHLRAVAKPGGLFEDTVVTRLRWRGQTRRVRMVIYRRAT
GQASRRGQTPEQMLNIVCDRLCGGLANAGIQARRMVAADVHDWLLRWFNPRPAMLGPSAEDRERFYALAR
YPDSTEESEAGEIELASGRDFSQRLFFGQPRSDVEHGTWYFDGMPHRVLITDRLRMPPGTGHLTGETRKG
DAINTLFDQMPEDTLLCLTMVATPQDVLEADLNHLAKKAVGETLASEQTLKDVQEARSLIGSAHKLYRGT
LAFYLRGRDEAELDRRGLDLANVMLNAGLQPVREDDEVAPLNSYLRWLPCCYNPGQDRRKWYTQLMFAQH
AANLSPVWGRAQGTGHPGITMFNRGGGPITFDPLSRLDRQMNAHLFLFGPTGSGKSATLNNLLNQVTAIY
RPRLFIVEAGNSFGLFSDFARMLGLTVNRVKLAPGSGISLAPFADARRLIETPSDVQTLDADALDEDLRP
HWPASLHPTGRPPSSGRPSGRRRPRRRPQ
 
Nucleotide Sequence: 1980 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c1228584-1226605 Acidovorax ebreus TPSY chromosome, complete genome
ATGCGCTGGGAACTTCCCTGGCCGAAGCTGGCCGCATCCGGCACCGGCGACGAAGAGAAGCCGGACGGCT
GGCAGCGCCACGTCGAGGCCTTGCGCCAGGCCGGCGTCCCTGAACCCGGCGCAGCGGTCCAGGGCCGCAG
GCCGGCGACGGTAGCCGACGAGCAGGCGCTGTACGACGTCGCGCCGTCGTTCGCGGAACTGCTGCCTTGG
GTGGAGTTCTTGCCGCAGTCGAAGTCCATGCTGCTGGAGGATGGGCAGTCGGTCGCTGCCTTCTACGAGC
TGGTGCCGCTGGGCACCGAGGGGCGGGAGCCCGGCTGGCTCGCGCATGCCCGCGATGCCTTGGAGAACGC
GCTCCAGGACTCGTTCGATGAGCTGGACGAAAACCCCTGGGTACTCCAGCTCTATGCCCAGGACGAGCCC
AGCTTCGACCAGTACATGCAGACCCTGCGCGACTACGTGCAGCCGCGTGCCCGCGGCACCGCTTTCACCG
AGTTCTACTTGCGCTTCTTCGGCCACCACCTGCGCGCGGTCGCCAAGCCGGGCGGCCTGTTCGAGGACAC
GGTGGTCACGCGGCTGCGCTGGCGCGGCCAGACGCGGCGGGTGCGCATGGTGATCTATCGCCGTGCAACT
GGGCAGGCAAGCCGCCGCGGCCAGACGCCCGAGCAGATGCTGAACATCGTCTGCGACCGCCTGTGCGGCG
GCCTGGCGAACGCCGGCATCCAGGCACGGCGCATGGTCGCAGCCGACGTCCACGACTGGCTGCTGCGGTG
GTTCAATCCGCGCCCGGCGATGCTTGGACCGAGTGCAGAGGACCGGGAGCGCTTCTACGCGCTGGCGCGC
TACCCCGACAGCACCGAAGAAAGCGAGGCCGGCGAAATCGAGCTGGCGAGCGGGCGGGATTTCAGCCAGC
GGCTGTTCTTCGGCCAGCCACGCTCCGACGTGGAGCACGGCACCTGGTATTTCGACGGCATGCCGCACCG
CGTGCTGATCACCGACCGGCTGCGCATGCCGCCCGGCACCGGACACCTGACCGGCGAGACCCGCAAAGGG
GATGCCATCAACACGCTGTTCGACCAGATGCCGGAAGACACCTTGCTGTGTCTCACGATGGTCGCCACGC
CGCAGGATGTCCTGGAAGCGGATCTCAACCACCTGGCGAAGAAGGCCGTGGGCGAGACGCTGGCGTCGGA
GCAGACGTTGAAGGACGTGCAGGAAGCCCGCTCCCTCATCGGCAGCGCACACAAGCTCTACCGGGGGACG
CTGGCATTCTACCTGCGCGGACGCGACGAAGCGGAACTGGACCGGCGCGGCCTGGACCTGGCGAACGTGA
TGCTCAATGCTGGCTTGCAGCCGGTGCGCGAGGACGACGAGGTGGCGCCGCTCAACAGCTACTTGCGGTG
GCTGCCATGCTGCTACAACCCCGGCCAGGATCGGCGCAAGTGGTACACCCAACTGATGTTCGCTCAGCAC
GCGGCGAACCTGTCGCCGGTGTGGGGCCGCGCTCAAGGTACGGGGCACCCGGGCATCACGATGTTCAACC
GCGGTGGCGGGCCGATCACCTTCGACCCGCTCAGCCGCCTGGATCGGCAGATGAACGCCCATCTGTTCCT
GTTCGGCCCCACCGGCTCCGGCAAGAGCGCCACGCTCAACAACCTCTTGAATCAGGTCACGGCCATCTAC
CGACCGCGGCTGTTCATCGTGGAGGCTGGCAACAGCTTCGGCCTGTTCAGCGACTTCGCACGCATGCTCG
GGCTGACGGTAAACCGGGTCAAGCTGGCCCCAGGTTCGGGCATCAGCCTCGCGCCATTCGCAGACGCGCG
TCGGCTGATCGAGACGCCCAGCGACGTGCAGACGCTCGACGCCGACGCGCTGGATGAAGACCTCCGCCCG
CACTGGCCTGCATCGCTTCACCCGACGGGACGACCACCTTCTTCTGGACGGCCATCAGGCCGGCGGCGAC
CACGACGGCGCCCGCAATGA
 Primer design