SecReT4
Protein ID: 222110373
T4SS name [ID]Tfc [758]
Gene symbol-
Locus tagDtpsy_1165
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]1228584..1229024 [-]
Producthypothetical protein
Component typeTfc15
UniProt IDB9MG46
KEGG IDdia:Dtpsy_1165
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 146 a.a.     [Download]
>gi|222110373|ref|YP_002552637.1| hypothetical protein Dtpsy_1165 [Acidovorax ebreus TPSY]
MRSNSIKGLALAAAVAVLSGCATSKEELLTHSDRTMMDIWQQETGGGGSGTGQVARRQLLDARQSLRRPL
TDADVQAAPVEQMRYTRTARNEVYRQFQRLPNPDLVMYVYPHLAGTDPVPVPGYTTVFPLYQRVQYAMPG
ERLEDY
 
Nucleotide Sequence: 441 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c1229024-1228584 Acidovorax ebreus TPSY chromosome, complete genome
ATGCGCTCGAACTCGATTAAGGGCCTCGCGCTGGCCGCGGCCGTCGCCGTGCTCAGCGGTTGCGCCACCA
GCAAGGAAGAACTGCTGACCCATAGCGACCGCACCATGATGGACATCTGGCAGCAGGAAACGGGTGGCGG
CGGCAGTGGCACCGGCCAGGTCGCGCGCCGGCAGTTGCTCGACGCGCGCCAGAGCCTGCGCCGGCCGCTG
ACCGACGCCGATGTGCAGGCTGCGCCCGTCGAGCAGATGCGCTACACGCGCACGGCGCGCAACGAGGTTT
ATCGCCAGTTCCAGCGCCTGCCCAACCCCGATCTCGTCATGTATGTGTACCCGCACCTGGCGGGCACGGA
CCCCGTGCCGGTTCCGGGCTACACGACGGTCTTCCCCCTGTACCAGCGCGTGCAGTACGCCATGCCCGGT
GAACGGCTGGAGGACTATTGA
 Primer design