SecReT4
Protein ID: 222110374
T4SS name [ID]Tfc [758]
Gene symbol-
Locus tagDtpsy_1166
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]1229005..1230423 [-]
Producthypothetical protein
Component typeTfc14
UniProt IDB9MG47
KEGG IDdia:Dtpsy_1166
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 472 a.a.     [Download]
>gi|222110374|ref|YP_002552638.1| hypothetical protein Dtpsy_1166 [Acidovorax ebreus TPSY]
MRSNGLLKWLMIPVALLVLFVAIRLFSGGSTSAPPAADAGSKLTPEEMKALGIEGDTPRDTVATLVAQVK
QLRTELQTALTDNKSQREENQRLRQRENSIDQRINSALESERSNLRRDQEQAASARQQTEGLLADLQRRL
DSIGGRGGGHADLPVGLGLRGGDEAGMEGGMRWVEPDDAKKAEGRNGSRGAGSGMSFPTSFGPAQSTLET
TAETVANAGAGAAGVKSAKPVYTVPTNSTLMGSVAMTALIGRVPIDGTVNDPYPFKVLVGPDNLTANGID
IPDVAGAVFSGTASGDWTLSCVRGQVRSITFVFNDGTIRTIPEDREGNQQNNQQRDGLGWISDPHGIPCV
SGERRSNAQQYLGSQALITAAGAGVASLIESDSGRMSYVGSDGAIGTVGISGKEAVGQILAGGVRDMSTW
VNKLYGQAFAAVYVQPGAKVAVHLEKPLAIDHDPEGRRVDHRAGESHALELD
 
Nucleotide Sequence: 1419 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c1230423-1229005 Acidovorax ebreus TPSY chromosome, complete genome
ATGCGCAGTAACGGCTTGCTCAAGTGGCTGATGATCCCGGTCGCCTTGCTGGTGCTGTTCGTTGCCATCC
GGCTGTTCTCCGGTGGAAGCACGTCGGCACCGCCCGCCGCGGATGCTGGCTCCAAGCTCACGCCCGAGGA
AATGAAGGCGTTGGGCATCGAAGGCGATACCCCGCGCGATACCGTGGCAACGCTCGTCGCCCAGGTGAAA
CAGTTGCGCACCGAGCTTCAGACCGCGCTGACCGACAACAAGTCGCAGCGCGAGGAAAACCAGCGGCTGC
GCCAGCGGGAGAACTCCATTGATCAGCGCATCAATTCGGCCCTCGAATCCGAGCGCTCCAACCTGCGCCG
CGACCAGGAACAGGCGGCCAGCGCGCGCCAGCAGACCGAGGGGCTGCTCGCCGACCTGCAGCGGCGCCTG
GACAGCATTGGCGGGCGCGGCGGCGGTCACGCTGATCTGCCGGTGGGCCTGGGGCTGCGCGGCGGCGACG
AGGCCGGCATGGAAGGCGGCATGCGCTGGGTCGAACCGGACGACGCGAAGAAGGCCGAGGGCCGCAATGG
CAGTCGTGGCGCAGGCAGCGGCATGAGCTTCCCGACGAGCTTCGGCCCGGCACAAAGCACACTGGAAACC
ACCGCGGAAACCGTGGCGAACGCCGGCGCAGGTGCGGCAGGCGTCAAGAGCGCCAAGCCGGTCTATACCG
TGCCGACCAACTCGACACTGATGGGCTCCGTGGCGATGACGGCGCTGATTGGGCGCGTGCCGATCGACGG
GACGGTGAACGATCCGTACCCCTTCAAGGTGCTGGTCGGGCCGGACAATCTGACTGCCAACGGCATCGAC
ATTCCCGACGTGGCCGGCGCGGTGTTCTCCGGAACCGCATCGGGCGACTGGACGCTCTCGTGCGTGCGCG
GCCAGGTTCGCAGCATCACCTTCGTCTTCAACGACGGCACGATCCGCACGATTCCCGAAGACCGCGAAGG
CAACCAGCAGAACAACCAGCAGCGCGACGGCCTGGGCTGGATCAGCGACCCGCACGGCATCCCGTGCGTC
AGCGGCGAACGGCGCAGCAACGCCCAGCAGTACCTCGGGTCGCAAGCTCTGATCACCGCGGCCGGAGCCG
GCGTGGCCTCGCTCATCGAGAGCGACAGCGGCCGCATGTCCTACGTCGGCTCGGACGGCGCCATCGGCAC
CGTGGGCATCAGCGGCAAGGAAGCAGTCGGCCAGATCCTCGCGGGCGGCGTCCGGGACATGTCGACCTGG
GTCAACAAGCTCTACGGACAGGCTTTCGCCGCCGTCTATGTGCAGCCAGGCGCCAAGGTCGCCGTCCACC
TCGAAAAGCCGCTGGCCATCGATCACGACCCCGAAGGCCGGCGCGTCGATCACCGTGCAGGAGAAAGCCA
TGCGCTCGAACTCGATTAA
 Primer design