SecReT4
Protein ID: 222110375
T4SS name [ID]Tfc [758]
Gene symbol-
Locus tagDtpsy_1167
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]1230413..1231330 [-]
Producthypothetical protein
Component typeTfc13
UniProt IDB9MG48
KEGG IDdia:Dtpsy_1167
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 1.7e-125, Aligned region: 7..287
Protein Sequence: 305 a.a.     [Download]
>gi|222110375|ref|YP_002552639.1| hypothetical protein Dtpsy_1167 [Acidovorax ebreus TPSY]
MKHPVLVLLGLLAVAAAPVSHAVEILRWERMPLAVPLKVGQERIVFIDRNVRVGVPAGVGERLRVQSAGG
AVYLRASEPIEPTRLQLQDADTGALILLDIAAEPPKDGEAELEPVRIVEGSSTPARYGDQPGGADEAPAR
AQDQAGTRATRRETPVPVVLTRFAAQNLYAPLRTVESLPGVMRVNLRRDLDLGTLMPTLPVRAVALASWR
LEDQWVTAVRLTNSSSGWVTLDPRVLQGDFLTATFQHEALGPRGTPEDTTVLYLVTRGHGLAQSLLPAIH
RFDPAVHLPQREAEADDGKEARHAQ
 
Nucleotide Sequence: 918 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c1231330-1230413 Acidovorax ebreus TPSY chromosome, complete genome
ATGAAGCATCCTGTACTCGTGCTGCTGGGGCTGCTGGCCGTGGCCGCGGCACCCGTCTCCCATGCTGTGG
AGATTCTGCGGTGGGAACGCATGCCGCTGGCGGTGCCGCTGAAGGTCGGCCAGGAGCGCATCGTGTTCAT
CGACCGGAACGTCCGCGTGGGCGTGCCCGCAGGCGTGGGCGAACGCCTGCGCGTGCAGAGCGCAGGTGGC
GCGGTGTACCTGCGCGCCAGCGAGCCGATCGAGCCCACGCGGCTGCAATTGCAGGACGCCGACACGGGCG
CGCTGATCCTGCTCGACATTGCGGCCGAGCCGCCCAAAGACGGCGAAGCCGAGCTGGAGCCGGTGCGCAT
CGTCGAGGGCAGCAGCACCCCTGCGCGCTACGGCGATCAGCCAGGCGGTGCCGATGAGGCCCCGGCACGC
GCCCAGGACCAAGCAGGTACGCGGGCGACCCGGCGCGAAACCCCGGTTCCGGTCGTCCTGACGCGCTTCG
CCGCGCAGAACCTCTACGCGCCGCTGCGCACTGTGGAGTCGCTGCCTGGCGTCATGCGGGTGAACCTGCG
CCGTGACCTCGACCTCGGCACGCTGATGCCGACGCTGCCGGTGCGCGCGGTCGCGCTCGCGTCGTGGCGT
CTGGAAGACCAGTGGGTCACGGCCGTGCGCCTGACCAACAGCAGCAGCGGCTGGGTCACGCTCGACCCGC
GCGTGCTGCAAGGCGATTTCCTCACCGCCACCTTCCAGCACGAAGCGCTCGGACCGCGCGGGACGCCCGA
GGACACGACCGTCCTGTACCTGGTGACGCGCGGGCACGGCCTCGCGCAATCGCTGCTGCCGGCGATCCAC
CGCTTCGACCCGGCCGTGCATCTGCCGCAGCGGGAAGCTGAAGCCGACGATGGCAAGGAGGCCCGCCATG
CGCAGTAA
 Primer design