SecReT4
Protein ID: 222110376
T4SS name [ID]Tfc [758]
Gene symbol-
Locus tagDtpsy_1168
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]1231327..1232019 [-]
Producthypothetical protein
Component typeTfc12
UniProt IDB9MG49
KEGG IDdia:Dtpsy_1168
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 1.5e-89, Aligned region: 6..206
Protein Sequence: 230 a.a.     [Download]
>gi|222110376|ref|YP_002552640.1| hypothetical protein Dtpsy_1168 [Acidovorax ebreus TPSY]
MSRFKNEITHLQAHIKTLRLGAGALVIVALVMGGGWWSAPRDLTIHVPPDLRSGSTRKWWEVPPESVYAF
TFYVFQTLNRWPTNGEEDYPRNLHTLSPYLTPSCQAFLRADYDYRRSTGELRQRVRGIYEIPGRGYGDDP
TARVRVVSDRDWVVTLDITADEYYGAEQVKRALVRYPVKVTRVDVDPARNPFGLALDCYDGAPQRISAPE
PTRPAPGGLSPQAPQGGNTP
 
Nucleotide Sequence: 693 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c1232019-1231327 Acidovorax ebreus TPSY chromosome, complete genome
ATGAGCCGCTTCAAGAACGAGATCACCCACCTGCAGGCGCACATCAAGACGCTTCGCCTGGGTGCTGGTG
CGCTGGTCATCGTCGCCCTGGTCATGGGCGGTGGCTGGTGGAGCGCGCCGCGCGACCTGACCATCCACGT
CCCGCCCGACCTGCGCTCGGGCAGTACCCGCAAGTGGTGGGAAGTGCCGCCCGAATCGGTCTATGCGTTC
ACGTTCTACGTGTTCCAGACCCTCAACCGCTGGCCGACGAACGGCGAAGAGGACTATCCGCGCAACCTCC
ACACGCTCTCGCCGTACCTTACCCCGTCCTGCCAGGCCTTCCTGCGCGCGGACTACGACTACCGCCGTTC
CACGGGCGAGCTGCGCCAGCGCGTGCGCGGGATTTATGAGATCCCCGGCCGCGGCTACGGCGACGACCCC
ACGGCGCGCGTGCGCGTGGTCTCCGACCGCGACTGGGTGGTGACGCTCGACATCACCGCCGACGAGTACT
ACGGCGCCGAGCAGGTCAAGCGCGCGCTCGTGCGCTACCCGGTGAAGGTCACGCGGGTGGACGTCGATCC
CGCCCGCAACCCCTTCGGCCTGGCGCTGGACTGCTACGACGGCGCGCCCCAGCGCATCAGCGCACCGGAG
CCGACTCGCCCGGCACCTGGCGGCCTGTCTCCGCAAGCGCCCCAAGGAGGAAACACCCCATGA
 Primer design