SecReT4
Protein ID: 222110377
T4SS name [ID]Tfc [758]
Gene symbol-
Locus tagDtpsy_1169
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]1232016..1232426 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDB9MG50
KEGG IDdia:Dtpsy_1169
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 4.5e-49, Aligned region: 10..133
Protein Sequence: 136 a.a.     [Download]
>gi|222110377|ref|YP_002552641.1| hypothetical protein Dtpsy_1169 [Acidovorax ebreus TPSY]
MSEQQHVRADGTVTFLPHRLNRHPVVVRGLTADELWICCGLSGAAGLLVGAPLSWVFRTIAIAPTFVVLG
VALGVFIGGGILRRLKRGRPDTWLYRQLQWRIATRHPLMAGWVGGHVLISRSGFWSTRRSVARGAR
 
Nucleotide Sequence: 411 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c1232426-1232016 Acidovorax ebreus TPSY chromosome, complete genome
ATGTCCGAGCAGCAGCACGTCCGTGCGGACGGGACGGTCACGTTCCTTCCGCATCGGCTCAACCGCCACC
CTGTTGTCGTGCGCGGCCTCACCGCCGACGAACTGTGGATCTGCTGCGGCCTGTCCGGCGCCGCCGGCCT
GCTGGTCGGCGCGCCGCTGTCCTGGGTGTTCCGCACGATCGCCATCGCGCCGACGTTCGTCGTCCTGGGC
GTGGCCCTGGGCGTCTTCATCGGCGGCGGCATCCTGCGCCGGCTCAAGCGCGGGCGCCCCGACACCTGGC
TGTACCGGCAACTGCAATGGCGCATCGCCACGCGCCATCCACTGATGGCGGGATGGGTAGGCGGCCACGT
GCTGATCTCGCGCTCCGGCTTCTGGTCCACCCGAAGGTCCGTTGCAAGGGGGGCACGATGA
 Primer design