SecReT4
Protein ID: 222110378
T4SS name [ID]Tfc [758]
Gene symbol-
Locus tagDtpsy_1170
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]1232439..1232798 [-]
Producthypothetical protein
Component typeTfc10
UniProt IDB9MG51
KEGG IDdia:Dtpsy_1170
PDB IDNA
Domain hit(s) vs Pfam DUF2976 [PF11190], Evalue: 5.1e-34, Aligned region: 32..118
Protein Sequence: 119 a.a.     [Download]
>gi|222110378|ref|YP_002552642.1| hypothetical protein Dtpsy_1170 [Acidovorax ebreus TPSY]
MQNRILHSRLAQRAAVALGSAALPALSFAQGLPQLENPTRGTGNGIMETIRNYGYDIIMLVALLVVASMF
IGVCYHAYGTYAEIHTGRKTWGQFGLTVAIGAVLLVIGIWLLTEATGIL
 
Nucleotide Sequence: 360 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c1232798-1232439 Acidovorax ebreus TPSY chromosome, complete genome
ATGCAAAACCGCATCCTCCATTCCCGCCTTGCCCAGCGCGCCGCTGTGGCACTGGGCTCCGCCGCGCTGC
CCGCGCTGTCGTTCGCGCAAGGCTTGCCGCAGTTGGAAAACCCGACCCGCGGCACCGGCAACGGCATCAT
GGAAACGATCAGGAACTACGGCTACGACATCATCATGCTCGTAGCCCTCCTGGTCGTGGCGTCGATGTTC
ATCGGCGTCTGCTACCACGCCTACGGCACCTACGCGGAAATCCACACCGGCCGCAAGACCTGGGGCCAGT
TTGGCCTCACCGTCGCGATCGGTGCCGTGCTGCTCGTGATCGGCATCTGGCTGCTCACCGAAGCCACCGG
CATCCTGTAA
 Primer design