SecReT4
Protein ID: 222110380
T4SS name [ID]Tfc [758]
Gene symbol-
Locus tagDtpsy_1172
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]1233045..1233425 [-]
Productplasmid protein raqprd
Component typeTfc9
UniProt IDB9MG53
KEGG IDdia:Dtpsy_1172
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2.4e-29, Aligned region: 29..109
Protein Sequence: 126 a.a.     [Download]
>gi|222110380|ref|YP_002552644.1| plasmid protein raqprd [Acidovorax ebreus TPSY]
MLAPIWQRAAHRGVPIFLVTALLLGQSPMALAESPAQRQELVAALRQLDALERTVADSAARAPIQPGERY
HFDYPRLLADLARVRAGIQAHLTPSRAQPRDPSELASDYRTERSASPSPTTTEAKP
 
Nucleotide Sequence: 381 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c1233425-1233045 Acidovorax ebreus TPSY chromosome, complete genome
ATGTTGGCTCCGATCTGGCAGCGCGCCGCGCATCGCGGCGTGCCCATTTTTCTCGTGACGGCCCTGCTGC
TGGGTCAGTCCCCGATGGCGTTGGCCGAGTCCCCCGCACAGCGCCAGGAGCTGGTCGCCGCGCTGCGCCA
ACTCGACGCGCTGGAGCGCACCGTCGCCGACAGCGCCGCGCGTGCCCCCATCCAGCCGGGCGAGCGCTAC
CACTTCGATTACCCGCGGTTGCTGGCTGACTTGGCGCGCGTGCGCGCCGGCATCCAGGCCCATCTCACAC
CGTCGCGTGCCCAGCCGCGCGACCCCTCCGAACTGGCCAGCGACTACCGCACCGAGCGGTCCGCTTCGCC
ATCGCCGACGACTACGGAAGCCAAGCCATGA
 Primer design