SecReT4
Protein ID: 222110382
T4SS name [ID]Tfc [758]
Gene symbol-
Locus tagDtpsy_1174
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]1234610..1235371 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDB9MG55
KEGG IDdia:Dtpsy_1174
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1e-68, Aligned region: 46..250
Protein Sequence: 253 a.a.     [Download]
>gi|222110382|ref|YP_002552646.1| hypothetical protein Dtpsy_1174 [Acidovorax ebreus TPSY]
MKDAASTAQREQNQRQGLIVGTITLPFRLLGVLIGSLLFSIVVECVGMHLFWKDQGWRHSQQMLQYELGH
LSSHFTRSVVVQEPGRTAHELVDTGYEWVFVRSGLLERMSQTAERARAPSHGRIQDGGRNFRYYISQVYV
WTENYLIAAAFTTLTFLVRLLVLVLTLPLICTAAFVGLIDGLVRRDVRRFGAGRESGFIYHRAKASLMPL
AVLPWVTYLALPISVHPLLILLPSAALLGLAVSLTAGSFKKYL
 
Nucleotide Sequence: 762 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c1235371-1234610 Acidovorax ebreus TPSY chromosome, complete genome
ATGAAGGACGCCGCCTCGACTGCACAACGGGAGCAGAACCAGCGCCAGGGCCTGATCGTCGGCACCATCA
CCTTGCCGTTCCGGCTGCTCGGGGTGCTGATCGGCTCGCTGCTGTTCTCGATCGTCGTGGAGTGCGTCGG
CATGCACCTGTTCTGGAAGGACCAGGGCTGGCGGCACTCGCAGCAGATGTTGCAGTACGAACTGGGGCAC
CTGTCCAGCCACTTCACGCGCAGCGTCGTCGTGCAGGAGCCGGGGCGCACCGCGCACGAACTGGTGGATA
CCGGCTACGAATGGGTATTCGTTCGCTCCGGGCTGCTGGAGCGCATGAGCCAGACCGCCGAGCGCGCCCG
CGCGCCGAGCCACGGGAGGATCCAGGACGGGGGGCGCAACTTTCGCTACTACATCAGCCAGGTCTATGTC
TGGACCGAGAACTACCTGATTGCCGCGGCCTTCACCACCCTCACGTTTCTGGTGCGCCTGCTGGTTCTGG
TGCTCACGTTGCCGCTGATCTGCACCGCGGCGTTCGTCGGCCTGATCGACGGTCTTGTGCGGCGGGACGT
GCGCCGGTTCGGCGCAGGCCGGGAATCCGGCTTCATCTACCACCGCGCGAAGGCGAGCCTGATGCCGCTG
GCCGTGCTGCCGTGGGTCACGTACCTGGCCTTGCCGATCTCTGTGCATCCACTGCTGATCCTGCTGCCCA
GCGCAGCCTTGCTGGGACTGGCCGTGAGCCTGACTGCGGGCAGCTTCAAAAAATACTTGTGA
 Primer design