SecReT4
Protein ID: 222110383
T4SS name [ID]Tfc [758]
Gene symbol-
Locus tagDtpsy_1175
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]1235368..1236240 [-]
Producthypothetical protein
Component typeTfc6
UniProt IDB9MG56
KEGG IDdia:Dtpsy_1175
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 3.2e-15, Aligned region: 67..197
TrwB_AAD_bind [PF10412], Evalue: 5.8e-06, Aligned region: 69..210
Protein Sequence: 290 a.a.     [Download]
>gi|222110383|ref|YP_002552647.1| hypothetical protein Dtpsy_1175 [Acidovorax ebreus TPSY]
MSGKQPVEVLLRPAVELYTVAACAGAAFLSLVAPWSLALSPSMGVGSALAFGAYGGLPGASAGARVPINV
HADEFNELMGDEFIPLINKGGGAGLQVTAYTQTLSDIEARIGNRAKAGQVIGNFNNLFMLRVRETATAEL
LTRQLPKVEVYTTTIVSGATDSSDIRGATDFTSNTQDRISMSSVPMIEPSHVVGLPKGQCFALLQGGQLW
KVRMPLPAPDPDEVMPADLQQLAGYMRQSYSEATQWWEFTSSPALQDTGLPDDLLDDAAAAEPPAVAIAT
DEDTGNKASP
 
Nucleotide Sequence: 873 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c1236240-1235368 Acidovorax ebreus TPSY chromosome, complete genome
ATGTCGGGGAAACAGCCGGTCGAGGTACTGCTTCGCCCAGCGGTGGAGCTATACACCGTTGCCGCATGCG
CGGGCGCCGCGTTTCTGTCCCTGGTGGCCCCATGGTCGCTCGCGCTGAGCCCGTCCATGGGCGTCGGCAG
CGCGCTGGCGTTCGGCGCCTACGGTGGCCTGCCGGGCGCATCGGCCGGTGCGCGCGTGCCGATCAACGTC
CATGCCGACGAGTTCAACGAATTGATGGGCGACGAGTTCATCCCGCTGATCAACAAGGGCGGCGGTGCCG
GCCTGCAAGTCACTGCGTACACGCAGACCCTGTCGGACATCGAGGCCCGCATCGGCAACCGCGCGAAGGC
AGGCCAGGTGATCGGGAATTTCAACAACCTGTTCATGCTGCGCGTGCGCGAGACCGCGACCGCCGAACTG
CTGACCCGGCAATTGCCGAAGGTCGAGGTCTATACGACCACCATCGTCAGCGGCGCGACCGACAGCTCGG
ACATTCGCGGGGCGACGGATTTCACGTCGAACACTCAGGACCGCATCAGCATGTCCAGCGTGCCGATGAT
CGAGCCGTCGCACGTCGTCGGCCTGCCGAAAGGCCAGTGCTTCGCGTTGCTGCAGGGCGGCCAGCTTTGG
AAAGTGCGCATGCCGCTGCCGGCGCCGGACCCGGACGAAGTGATGCCGGCAGACTTGCAGCAACTGGCCG
GGTACATGCGCCAGAGCTACAGCGAAGCGACGCAGTGGTGGGAGTTCACCAGTTCCCCCGCCTTGCAGGA
CACGGGCCTGCCCGACGACCTGCTGGATGACGCCGCTGCGGCCGAACCTCCCGCGGTGGCCATTGCCACC
GACGAGGACACCGGCAACAAGGCCTCGCCATGA
 Primer design