SecReT4
Protein ID: 222110384
T4SS name [ID]Tfc [758]
Gene symbol-
Locus tagDtpsy_1176
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]1236245..1236784 [-]
Producthypothetical protein
Component typeTfc5
UniProt IDB9MG57
KEGG IDdia:Dtpsy_1176
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 1.1e-52, Aligned region: 31..178
Protein Sequence: 179 a.a.     [Download]
>gi|222110384|ref|YP_002552648.1| hypothetical protein Dtpsy_1176 [Acidovorax ebreus TPSY]
MTTSHLALRGLLVLLAGLPLASLAGEPLIVVEDRGGASALPYYEALNLQPRTNAPARPPIPTPQVPATPA
DEAAMLPVRSAKLTPGTVPRRVIEAPGLRPFVVVGDDEASRAWLRSQAAALRERGAVGLVVNVETVQGLA
RLRTLVPGVPLAPMSGDDLAERLGLRHYPVLITATGIEQ
 
Nucleotide Sequence: 540 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c1236784-1236245 Acidovorax ebreus TPSY chromosome, complete genome
ATGACGACATCCCATCTGGCCTTGCGTGGCCTGCTCGTACTGCTGGCGGGTCTGCCGCTGGCCTCGCTTG
CCGGCGAGCCGCTGATCGTGGTCGAAGACCGCGGCGGCGCGTCGGCGCTGCCGTACTACGAAGCCCTGAA
CCTCCAGCCGCGCACCAACGCACCGGCCCGGCCGCCGATCCCGACGCCCCAGGTTCCCGCCACGCCGGCG
GACGAGGCCGCGATGCTGCCGGTGCGCAGCGCCAAGCTCACCCCCGGCACCGTCCCGCGGCGTGTCATCG
AGGCTCCGGGTCTGCGGCCTTTCGTTGTCGTCGGCGACGACGAGGCATCTCGGGCCTGGCTGCGCAGCCA
GGCAGCCGCGCTGCGCGAGCGCGGCGCGGTCGGTCTGGTGGTCAACGTCGAGACCGTGCAGGGCCTGGCG
CGGCTGCGCACCCTGGTGCCCGGCGTACCCCTCGCGCCCATGTCCGGCGACGACCTGGCCGAGCGCCTGG
GCCTGCGGCACTACCCGGTGCTGATCACAGCCACCGGCATCGAGCAATGA
 Primer design