SecReT4
Protein ID: 222110385
T4SS name [ID]Tfc [758]
Gene symbol-
Locus tagDtpsy_1177
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]1236781..1237371 [-]
Productlytic transglycosylase subunit
Component typeTfc4
UniProt IDB9MG58
KEGG IDdia:Dtpsy_1177
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 196 a.a.     [Download]
>gi|222110385|ref|YP_002552649.1| lytic transglycosylase subunit [Acidovorax ebreus TPSY]
MAAPAIAAPLRTLVLAAGLCACVAQAQEVPPPAYQLAAQRAGIPSTVLYAVALQESGIRRNGRIVPWPWS
LNVAGQSRRYATRADACAGLQQAMRSTPHTRIDAGLGQINLGYHQQRYASACDLLDPYRNLAIAAEILRE
QHAPGEDWLLAMGRYHRPAGGEPAARYRRSVSRHLARVQGARPTAAVLAARKETSP
 
Nucleotide Sequence: 591 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c1237371-1236781 Acidovorax ebreus TPSY chromosome, complete genome
ATGGCAGCGCCAGCCATAGCCGCCCCCCTGCGCACACTGGTGCTCGCCGCTGGCCTATGCGCCTGCGTCG
CCCAAGCCCAGGAGGTTCCGCCACCGGCCTACCAGCTCGCCGCGCAGCGCGCAGGCATCCCCTCGACGGT
GCTCTACGCCGTGGCCTTGCAGGAGAGTGGCATCCGCCGTAACGGACGCATCGTCCCGTGGCCGTGGTCC
CTCAACGTCGCCGGCCAATCACGCCGCTATGCGACCCGCGCCGATGCCTGCGCGGGTTTGCAGCAGGCGA
TGCGCTCCACGCCGCACACGCGCATCGACGCGGGCCTGGGCCAGATCAACCTCGGCTACCACCAGCAGCG
CTACGCCAGCGCCTGCGACCTGCTCGACCCGTACCGGAATCTCGCCATCGCTGCCGAGATCCTGCGCGAG
CAACACGCCCCCGGCGAGGACTGGTTGCTGGCGATGGGCCGCTACCACCGCCCCGCGGGTGGCGAGCCCG
CCGCCCGCTACCGGCGCAGCGTGTCGCGCCACCTCGCCCGGGTGCAGGGCGCACGCCCAACCGCCGCGGT
TCTCGCCGCACGCAAGGAGACATCCCCATGA
 Primer design