SecReT4
Protein ID: 222110386
T4SS name [ID]Tfc [758]
Gene symbol-
Locus tagDtpsy_1178
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]1237353..1238078 [-]
Producthypothetical protein
Component typeTfc3
UniProt IDB9MG59
KEGG IDdia:Dtpsy_1178
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 241 a.a.     [Download]
>gi|222110386|ref|YP_002552650.1| hypothetical protein Dtpsy_1178 [Acidovorax ebreus TPSY]
MKPSIILSALLLASTQLPAWAQQSATAPARNAQSQERPLVARILDDRVASDWGLQPQEWARYRELMDGPL
GIYSPNLDPLSALGIEARTEEERRRYAELQVQVEARRVEKLLAYQRAYDEAWQRLNPGMQRVNLPDDKPV
AGATRGSGRTAVFVKDNCVACGQLVQRLQSSGAEFDLYMVGSRQDDARIRDWAKRANVDPARVRSGSITL
NHDGGRWLTLGVPGDLPAVVREVNGQWQRQP
 
Nucleotide Sequence: 726 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c1238078-1237353 Acidovorax ebreus TPSY chromosome, complete genome
ATGAAGCCGTCGATCATCCTTTCCGCGCTTCTGCTGGCGTCCACCCAGTTGCCCGCGTGGGCGCAGCAAT
CCGCCACGGCTCCCGCCCGCAATGCGCAGAGTCAGGAACGCCCGCTGGTCGCCCGCATTCTGGACGACCG
GGTGGCGAGCGACTGGGGCCTTCAACCTCAGGAGTGGGCGCGCTATCGCGAACTGATGGACGGTCCACTG
GGCATCTATTCGCCCAACCTGGACCCGCTGTCGGCCCTGGGCATCGAGGCGCGTACCGAAGAGGAACGGC
GACGCTACGCCGAGCTGCAGGTGCAGGTCGAAGCGCGCCGCGTGGAGAAACTGCTCGCTTATCAGCGGGC
CTATGACGAGGCCTGGCAGCGCCTGAACCCCGGGATGCAGCGGGTGAACCTGCCGGACGACAAGCCGGTC
GCCGGGGCCACGCGCGGCTCCGGCCGCACGGCAGTGTTCGTGAAAGATAACTGCGTGGCCTGCGGCCAGC
TCGTGCAGCGCCTGCAATCCTCGGGCGCCGAATTCGACCTGTACATGGTCGGCAGCCGCCAGGACGACGC
GCGCATCCGCGATTGGGCCAAGCGCGCGAACGTCGATCCGGCGCGCGTGCGCAGCGGCAGCATCACGCTC
AACCACGACGGCGGCCGCTGGTTGACCTTGGGGGTACCCGGCGACCTGCCGGCGGTCGTGCGCGAGGTGA
ACGGCCAATGGCAGCGCCAGCCATAG
 Primer design