SecReT4
Protein ID: 222110388
T4SS name [ID]Tfc [758]
Gene symbol-
Locus tagDtpsy_1180
StrainAcidovorax ebreus TPSY
Repliconchromosome [GenBank: NC_011992] [Browse all T4SS(s) in this replicon]
Location [Strand]1238731..1239330 [-]
Producthypothetical protein
Component typeTfc2
UniProt IDB9MG61
KEGG IDdia:Dtpsy_1180
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 199 a.a.     [Download]
>gi|222110388|ref|YP_002552652.1| hypothetical protein Dtpsy_1180 [Acidovorax ebreus TPSY]
MCPSPPWFHHPERRLLAGFLGLLWSVLAGGCATTSAPVAPDTIEEVSAAPVPEAPEYIPVVRYGRYTLVE
LAPTAAQRDLLLQTIDVSMPEDARATVGDGLRHVLKRSGYGLCQTTHAVIELYALPLPAAHLHLGPMTLR
DALLTLAGSAWELHADDRARQICFERPGDSMTADNVPAPPATEAVQTFPLAPAASGGQP
 
Nucleotide Sequence: 600 bp     [Download]
>gi|222109225|ref|NC_011992.1|:c1239330-1238731 Acidovorax ebreus TPSY chromosome, complete genome
ATGTGCCCCTCTCCACCTTGGTTTCACCATCCCGAACGCCGTCTGCTGGCGGGTTTTCTCGGCCTGCTTT
GGTCGGTGCTGGCTGGCGGCTGCGCGACGACGAGCGCGCCGGTCGCGCCCGACACCATCGAGGAAGTCTC
GGCCGCACCCGTACCCGAGGCGCCCGAATACATCCCCGTTGTGCGCTACGGCCGCTACACCCTCGTGGAA
CTGGCACCGACAGCAGCGCAGCGCGACCTGCTGTTGCAGACCATCGACGTGTCGATGCCCGAGGATGCAC
GCGCTACGGTCGGCGACGGGCTACGGCATGTGCTCAAGCGCAGCGGTTACGGCTTGTGCCAGACGACGCA
CGCGGTGATCGAGCTGTACGCACTGCCGCTGCCGGCGGCCCACCTGCACCTCGGCCCCATGACCCTGCGG
GATGCGCTGCTCACCCTGGCTGGTTCGGCCTGGGAACTGCACGCGGATGACCGCGCGCGGCAAATCTGCT
TCGAGCGGCCCGGCGACAGCATGACCGCCGACAACGTACCCGCGCCGCCTGCCACCGAGGCGGTGCAGAC
GTTCCCGCTGGCGCCCGCGGCATCGGGAGGCCAGCCATGA
 Primer design